Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38380-AT2G38390
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Peroxidase superfamily protein
Function (paralog2):Peroxidase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.5390868529632
Log2 mRNA fold difference:-1.5830357034103
Log2 TE fold difference:0.061555284076944
Sequences
Protein sequence

MGFSPSFSCSAIGALILGCLLLQASNSNAQLRPDFYFGTCPFVFDIIGNIIVDELQTDPR
IAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNANSARGFNVIDRMKVALERAC
PGRVSCADILTIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFFNLTQLKTA
FADVGLNRTSDLVALSGGHTFGRAQCQFVTPRLYNFNGTNSPDPSLNPTYLVELRRLCPQ
NGNGTVLVNFDVVTPDAFDSQYYTNLRNGKGLIQSDQELFSTPGADTIPLVNQYSSDMSV
FFRAFIDAMIRMGNLRPLTGTQGEIRQNCRVVNPRIRVVENDDGVVSSI

MGFSSSLSCSAMGALIVGCLLLQASNSNAQLRPDFYFRTCPPIFNIIGDTIVNELRTDPR
IAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNKNSVRGFDVIDRMKAAIERAC
PRTVSCADIITIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFSTLTQLKTA
FADVGLNRPSDLVALSGGHTFGKAQCQFVTPRLYNFNGTNRPDPSLNPTYLVELRRLCPQ
NGNGTVLVNFDSVTPTTFDRQYYTNLLNGKGLIQSDQVLFSTPGADTIPLVNQYSSNTFV
FFGAFVDAMIRMGNLKPLTGTQGEIRQNCRVVNPRIRVVENDDGVVSSI

Other information
Ka divergence:-0.109658KaKs divergence:0.99979
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1050Length 2 (bp):1050Length divergence:0
MFE 1 (kcal):-308.7MFE 2 (kcal):-302.03MFE divergence-0.011