Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38530-AT2G38540
Species:Arabidopsis
Duplication type:TD
Function (paralog1):lipid transfer protein 2
Function (paralog2):lipid transfer protein 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.7160116123259
Log2 mRNA fold difference:3.8526143889676
Log2 TE fold difference:-1.1470811109369
Sequences
Protein sequence

MAGVMKLACMVLACMIVAGPITANALMSCGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNL
KNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTVR

MAGVMKLACLLLACMIVAGPITSNAALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNL
NSIAKTTPDRQQACNCIQGAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTVR

Other information
Ka divergence:-0.414275KaKs divergence:0.969357
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):357Length 2 (bp):357Length divergence:0
MFE 1 (kcal):-116.9MFE 2 (kcal):-125.16MFE divergence0.034