Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38620-AT3G54180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cyclin-dependent kinase B1;2
Function (paralog2):cyclin-dependent kinase B1;1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1170197530734
Log2 mRNA fold difference:-1.6204249342268
Log2 TE fold difference:0.38939599698052
Sequences
Protein sequence

MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQ
SIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASL
VQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHE
IVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTP
TEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDH
PYFDSLDKSQF

MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLST
SIYVVRLLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQ
KLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIV
TLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTE
QQWPGVSTLRDWHVYPKWEPQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPY
FDSLDKSQF

Other information
Ka divergence:0.0869529KaKs divergence:0.0800745
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):936Length 2 (bp):930Length divergence:-0.003
MFE 1 (kcal):-248.01MFE 2 (kcal):-264.73MFE divergence0.033