Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38630-AT3G54190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.8381057166973
Log2 mRNA fold difference:1.4867730149117
Log2 TE fold difference:0.35056424136233
Sequences
Protein sequence

MMEGRRIIANPRPCSGSRRVIAKKRSRPDGFVNSVKKLQRREISSRMDRAFSISTAQERF
RNMRLVEQYDTHDPKGYCLVSLPNLLKRSKVIEIVAARDIVFALTLSGVCASFSRETNKK
VCFLNVSPDEVIRSLFYNKNNDSLITVSVYASDNYSSLKCRSTRIEYILRGQADAGFPLF
ESESLKWPGFVEFDDVNGKVLTYSAQDSVYKVFDLKNYALLYSISDKNVQEIKISPGIML
LIFKRAASHVPLKILSIEDGTLLKSFHHLLHRNKKVDFIEQFNEKLLVKQENENLQILDV
RNAELIEVSRTDFMTPSAFIFLYENQLFLTFRNRNVSVWNFRGELVTSFEDHLLWHPDCN
TNNIYITSDQDLIISYCKADTEDQWIEGNAGSINISNILTGKCLAKIKANNGPPKEEDCS
SSDLGNSSRRRSAVAEALEDITALFYDEERNEIYTGNRHGLLHVWSN

MEGRRITASPRPCSGRRIVAKKRSRPDGFVNSVKKLQRREISSRKDRAFSISTAQERFRN
MRLVEQYDTHDPKGHCLVALPFLMKRTKVIEIVAARDIVFALAHSGVCAAFSRESNKRIC
FLNVSPDEVIRSLFYNKNNDSLITVSVYASDNFSSLKCRSTRIEYILRGQPDAGFALFES
ESLKWPGFVEFDDVNGKVLTYSAQDSVYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLI
FKRAASHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDVRN
AELMEVSRAEFMTPSAFIFLYENQLFLTFRNRNVSVWNFRGELVTSFEDHLLWHPDCNTN
NIYITSDQDLIISYCKADTEDQWIEGNAGSINISNILTGKCLAKITPSSGPPKDDESSSS
NCMGKNSKQRRNAVAEALEDITALFYDEERNEIYTGNRHGLVHVWSN

Other information
Ka divergence:-0.364442KaKs divergence:-0.269781
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):1404Length 2 (bp):1404Length divergence:0
MFE 1 (kcal):-403.31MFE 2 (kcal):-395.46MFE divergence-0.01