Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38700-AT3G54250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mevalonate diphosphate decarboxylase 1
Function (paralog2):GHMP kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9330539619138
Log2 mRNA fold difference:-0.63853752770919
Log2 TE fold difference:-0.80149064827594
Sequences
Protein sequence

MAEEKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSF
DRDRMWLNGKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNF
PTAAGLASSAAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNK
EDGSDSVAVQLVDDKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPV
RILQMEEAIKNRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSA
GTPEIAYTFDAGPNAVMIARNRKVAVELLQGLLYCFPPKPDTDMKSYVLGDTSIVKEAGL
EGELPQGIKDKIGSQDQKGEVSYFICSRPGRGPVVLQDQTQALLHPQTGLPK

MATEKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAF
DRDRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNF
PTAAGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSK
EDGSDSVAVQLADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPK
RILQMEEAIKNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSE
GTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGL
DGASGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK

www.000webhost.com

Other information
Ka divergence:-0.40062KaKs divergence:-0.29059
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1239Length 2 (bp):1260Length divergence:0.008
MFE 1 (kcal):-375.5MFE 2 (kcal):-370.35MFE divergence-0.007