Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38810-AT3G54560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):histone H2A 8
Function (paralog2):histone H2A 11

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.3160222608488
Log2 mRNA fold difference:3.0974107245367
Log2 TE fold difference:-0.6579428410898
Sequences
Protein sequence

MAGKGGKGLLAAKTTAAAANKDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGA
TAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG
VIPHIHKSLVNKVTKD

MAGKGGKGLVAAKTMAANKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGA
TAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG
VIPHIHKSLINKTTKE

www.000webhost.com

Other information
Ka divergence:-0.363484KaKs divergence:-0.617347
GC content 1 (%):46GC content 2 (%):51GC content divergence:0.052
Length 1 (bp):411Length 2 (bp):411Length divergence:0
MFE 1 (kcal):-120.9MFE 2 (kcal):-135.6MFE divergence0.057