Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38860-AT3G54600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Class I glutamine amidotransferase-like superfamily protein
Function (paralog2):Class I glutamine amidotransferase-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.8700576256779
Log2 mRNA fold difference:1.5424973227376
Log2 TE fold difference:0.32880379268719
Sequences
Protein sequence

MASAVQKSALLLCGDYMEAYETIVPLYVLQSFGVSVHCVSPNRNAGDRCVMSAHDFLGLE
LYTELVVDQLTLNANFDDVTPENYDVIIIPGGRFTELLSADEKCVDLVARFAESKKLIFT
SCHSQVMLMAAGILAGGVKCTAFESIKPLIELSGGEWWQQPGIQSMFEITDCVKDGNFMS
TVGWPTLGHGIKLLLESLGGKVCSLEKKQASVLFLIGDYVEDYGINVPFRALQALGCKVD
AVTPNKKKGEVCATAVYDLEDGRQIPAEKRGHNFFVTASWDDICVDDYDCVVVPGGRSPE
LLVMNEKAVALVKSFAEKDKVFAAIGQGKLLLAATGVLKGKRCASGKGMKVMVKVAGGEA
VMEKGCVTDGKVVTAASATDLPAFLFDLSTALGLTVMF

MGSMAQKSVLMLCGEFMEAYETIVPLYVLQAFGVSVHCVSPGRKTGDKCVMAAHDLLGLE
IYTELVVDHLTLNANFDGVIPDQYDAIIIPGGRFTELLSADEKCVSLVARFAELKKLIFT
SCHSQLFLAAAGLLTGGMKCTAFESMKPFIELSGGAWWQQPGVQTLFEITDCVKDGSFMS
TMGWPTLGHSLKVLLESLGSKISSSKENHQTSLLFLIGDCVEDYSINVPFKAFQALGCKV
DAVTPTKKRGEKCATIVHDLEDGRQLPTEKFGHNFYVTVAWDDVSVDDYDCIVVPGGRSP
ELLVMNPKAVELVRKFVEKGKFVAAIGMGNWLLAATGALKKKRCASSYGTKVAVKVAGGE
IVESERCVTDDKLVTAASTSDLPAFLYALSTALGLSVVF

Other information
Ka divergence:0.111976KaKs divergence:0.448568
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1197Length 2 (bp):1200Length divergence:0.001
MFE 1 (kcal):-400MFE 2 (kcal):-423.4MFE divergence0.028