Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38940-AT3G54700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphate transporter 1;4
Function (paralog2):phosphate transporter 1;7

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.7551013552916
Log2 mRNA fold difference:-5.6968143257141
Log2 TE fold difference:1.9245201114489
Sequences
Protein sequence

MAREQLQVLNALDVAKTQWYHFTAIIIAGMGFFTDAYDLFCISLVTKLLGRIYYHVEGAQ
KPGTLPPNVAAAVNGVAFCGTLAGQLFFGWLGDKLGRKKVYGMTLMVMVLCSIASGLSFG
HEPKAVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFVSAVFAMQGFGIMAGG
IFAIIISSAFEAKFPSPAYADDALGSTIPQADLVWRIILMAGAIPAAMTYYSRSKMPETA
RYTALVAKDAKQAASDMSKVLQVEIEPEQQKLEEISKEKSKAFGLFSKEFMSRHGLHLLG
TTSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQSMNAIQEVFKIARAQTLIALCSTVPGY
WFTVAFIDVIGRFAIQMMGFFFMTVFMFALAIPYNHWTHKENRIGFVIMYSLTFFFANFG
PNATTFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQNPDKDKTDAGYPPGI
GVRNSLIVLGVVNFLGILFTFLVPESKGKSLEEMSGENEDNENSNNDSRTVPIV

MAGDQLNVLNALDVAKTQWYHFTAIIIAGMGFFTDAYDLFCISLVTKLLGRIYYHVDGSE
KPGTLPPNVSAAVNGVAFCGTLAGQLFFGWLGDKLGRKKVYGMTLMVMVLCSIASGLSFG
SNPKTVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFGILTGG
IFAIIVSAAFEAKFPAPTYQIDALASTVPQADYVWRIILMVGALPAAMTYYSRSKMPETA
RYTALVAKDAKLAASNMSKVLQVEIEAEQQGTEDKSNSFGLFSKEFMKRHGLHLLGTTST
WFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMNAIQEVFKIARAQTLIALCSTVPGYWFTV
AFIDVIGRFAIQMMGFFFMTVFMFALAIPYDHWTHKENRIGFVAMYSLTFFFANFGPNAT
TFVVPAEIFPARFRSTCHGISAASGKLGAMVGAFGFLYLAQSPDKTKTEHGYPPGIGVKN
SLIVLGVVNLLGMVFTLLVPESKGKSLEEMSGENEQNDESSSSSNNNSNNAVSTA

Other information
Ka divergence:-0.319272KaKs divergence:-0.371841
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1605Length 2 (bp):1608Length divergence:0.001
MFE 1 (kcal):-514.76MFE 2 (kcal):-521.55MFE divergence0.007