Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38970-AT3G54780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc finger (C3HC4-type RING finger) family protein
Function (paralog2):Zinc finger (C3HC4-type RING finger) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.6982727076996
Log2 mRNA fold difference:-2.5561801314963
Log2 TE fold difference:-0.16873377396619
Sequences
Protein sequence

MGTRWRRMKLALGLNLCTYLPRTLEESPTPLNSTERLSDVALLSPLNWPMTPTPSSHGLK
LSRNSSKSSKTCSICLNKMKEGGGHALFTAECSHSFHFHCIASNVKHGNQVCPVCRAKWK
EIPMQHPSFDLPYLFARSYNNDAAISLVHRLPRSRGVMNQGRGLAPEPSMFDDDERLEQQ
LVFSGKSYSDALENNHPVRMMDLKIYPEVSAVPRADSREKFDVLVHLRAAAMVTGNANSL
NNQISRYPRAPVDLVTVLDISGSMAGTKLALLKRAMGFVIQNLGSNDRLSVIAFSSTARR
LFPLTKMSDAGRQRALQAVNSVVANGGTNIAEGLRKGVKVMEDRRDKNPVASIILLSDGR
DTYTMNQADPNYKLLLPLSMHGCESKRFQIPVHSFGFGSDHDASLMHSVSETSGGTFSFI
ESESVIQDALAQCIGGLLSVAVQELRLEIEGMCSDVHLSSIKAGSYQSLVSGDGRSGCVD
IGDLYADEERDFLISVNIPPQKDGNETPLLKMRCVYKDLLTKEIVTLQSHMLKIQRPETV
GQEVVVSIEVDRQRNRFLAAEAMVKARALAEREDLAAGVTAIQNFRVALAETVSAKSGDG
FCVALDRELKEMQERMASRHVYEVSGRAYILSGLSSHSWQRATSRGESGDGSSFVQAYYQ
TPSMVEMLHRSQATSHHHRLIQPLFASQPKPR

MVSKWKKMKLALSLNLCNYLPRTLEEEPPSLALNSAETLSDAALLSPLNWPMTPTPSSYR
RRLSRSSSKSSKTCSICLNKMKEGCGHAIFTAECSHMFHFHCIASNVKHGNQVCPVCRAK
WKEIPIQKPSLDLPYYPFDRCNNDAAISLFRCLPPSQRAITQGHPEPATFDDDERLEEQI
VFDGETEVLKKENRDYVRMMDMKVYPEVSAVPQSKSCENFDVLVHLKAVTGDQISQYRRA
PIDLVTVLDISGSMGGTKLALLKRAMGFVIQNLGSSDRLSVIAFSSTARRLFPLTRMSDA
GRQLALQAVNSLVANGGTNIVDGLRKGAKVMEDRLERNSVASIILLSDGRDTYTTNHPDP
SYKVMLPQISVHSFGFGSDHDASVMHSVSEVSGGTFSFIESESVIQDALAQCIGGLLSVA
VQELRVEIEGVSPNVRLSSIKAGSYSSLVTGDGHSGLVDLGDLYADEERDFLVSINIPVE
EDGHTPLLKLRCLYINPLTKEITTLESHVLQIRRPEYVAEEKVVPIEVVRQRNRFLAAEA
MAQARTLAEHGDLEAAVKAIENFRLVLAETVAAKSCDRFCVALDSELKEMQGRMRSSHMY
EASGRAYILSGLSSHSWQRATARGNSRDSSSFVQAYQTPSMAEMLRRSQAMFLVSPSHHR
LIQPLLSFASQPKPR

Other information
Ka divergence:0.160973KaKs divergence:0.437037
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2079Length 2 (bp):2028Length divergence:-0.012
MFE 1 (kcal):-654.41MFE 2 (kcal):-624.7MFE divergence-0.023