Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39010-AT3G54820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plasma membrane intrinsic protein 2E
Function (paralog2):plasma membrane intrinsic protein 2;5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.1274908535776
Log2 mRNA fold difference:-2.6101816198717
Log2 TE fold difference:-0.36280164571224
Sequences
Protein sequence

MTKDELTEEESLSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLYVTVLTVIG
FKSQTDINAGGGACASVGLLGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVS
LVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVL
VYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARSFGAAVIYNN
QKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYGSVRSQLHELHA

MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIG
YKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVT
LVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGTGVAAEIIGTFVL
VYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYNK
DKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKALGSFRSQPHV

www.000webhost.com

Other information
Ka divergence:-0.138051KaKs divergence:-0.127669
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):870Length 2 (bp):861Length divergence:-0.005
MFE 1 (kcal):-316.8MFE 2 (kcal):-300.9MFE divergence-0.026