Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39020-AT2G39030
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Acyl-CoA N-acyltransferases (NAT) superfamily protein
Function (paralog2):Acyl-CoA N-acyltransferases (NAT) superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9801815236688
Log2 mRNA fold difference:2.0740535313233
Log2 TE fold difference:-0.11287629780471
Sequences
Protein sequence

MAAAAPPPPPTAAPEPNMVAPLISPIGHPMFSRIRLATPSDVPFIHKLIHQMAVFERLTH
LFSATESGLASTLFTSRPFQSFTVFLLEVSRSPFPATITSSPSPDFTPFFKTHNLDLPID
DPESYNFSPDMLNDVVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAV
AKQAVKMGYGRVEWVVLDWNVNAIKFYEQMGAQILQEWRVCRLTGDALEAFDQVNI

MAPPTAAPEPNTVPETSPTGHRMFSRIRLATPTDVPFIHKLIHQMAVFERLTHLFVATES
GLASTLFNSRPFQAVTVFLLEISPSPFPTTHDASSPDFTPFLETHKVDLPIEDPDREKFL
PDKLNDVVVAGFVLFFPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVAKQAVKLG
VGRVEWIVIDWNVNAINFYEQMGAQVFKEWRLCRLTGDALQAIDKLNI

www.000webhost.com

Other information
Ka divergence:0.372025KaKs divergence:0.53351
GC content 1 (%):47GC content 2 (%):51GC content divergence:0.041
Length 1 (bp):711Length 2 (bp):687Length divergence:-0.017
MFE 1 (kcal):-188.99MFE 2 (kcal):-200.2MFE divergence0.029