Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39130-AT3G54830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transmembrane amino acid transporter family protein
Function (paralog2):Transmembrane amino acid transporter family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.42477964307486
Log2 mRNA fold difference:-0.43827188961581
Log2 TE fold difference:0.10104956495326
Sequences
Protein sequence

MNHVPSDQSFYIESEDEDDRKDYVEEDGGSHSDSSDDVYDENQAHIKPSSYTTAWPQSYR
QSIDLYSSVPSPGIGFLGNNSMTRFGSSFLSSGLIRRHTPESLPTVTKPLLEEQADEQAL
PKHRLSSQGLLSPIPSRRGSMRKDEKSSMVSHEIPMSRNSSYGQAVLNGLNVLCGVGILS
TPYAAKEGGWLGLMILFVYGLLSFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVS
IVLYLELYACCVEYIILESDNLSSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRD
LSVLSYISAGGVIASVLVVLCLFWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHA
VFPNIYTSMAKPSQYPAVLLTCFGICTLMYAGVAVMGYTMFGESTQSQFTLNLPQDLIAT
KIAVWTTVVNPFTKYALTISPVAMSLEELIPSRHIRSHWYAIGIRTLLVFSTLLVGLAIP
FFGLVMSLIGSLLTMLVTLILPPACFLSIVRRKVTPTQMMLCVLIIIVGAISSVIGSYSA
LSKIVEKLTN

MNHSTSDQSLYIESDDGDDERKHLSDDEDDDGTLSDTSDAYNQNQHHLSKASPYSTAWPK
SYRQSIDMFGSVPSPNLGFLANSSMSRRGSSFMSSTLTRRHTPESLPCVTKPLLEDEEAP
KHKLSTHSLLPSKPSSSMVVSHDMGISNDSSFGQAVLNGVNVLCGVGILSTPYAVKEGGW
LGLIILFAFGILCFYTGLLLRYCLDSHPDVQTYPDIGHAAFGSTGRILVSVILYMELYAM
SVEYIILEGDNLSSMFPNASLSIGGFHLDAPRLFALLTTLAVLPTVWLRDLSVLSYISAG
GVIASVLVVLCLFWVGLVDDVGIHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTSMA
KPSQFSAVLLASFGICTLMYAGVAVMGYSMFGESTESQFTLNLPQDLVASKIALWTTVVN
PFTKYPLSRNIQRLFIYLFAMSLEELIPSNYGKSRFYAIAIRSALAISTLLVGLAIPFFG
LVMSLIGSFLTMLIFLDTDADTTASLFLEHLKEKSNPYSGDNLYLNYDSRSSMFSHWHIF
SPCKDH

Other information
Ka divergence:0.423706KaKs divergence:0.192615
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1653Length 2 (bp):1641Length divergence:-0.004
MFE 1 (kcal):-481.28MFE 2 (kcal):-455.6MFE divergence-0.027