Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39220-AT3G54950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PATATIN-like protein 6
Function (paralog2):patatin-like protein 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.16732845042865
Log2 mRNA fold difference:-0.25723436211833
Log2 TE fold difference:-0.046386641362959
Sequences
Protein sequence

MLTTMQRVHNKPIDSIGGFKHLVKQSNGGDGGVTATDMQEPSIETDKLSYEIFSILESKF
LFGYDDDLKLMESRSRDPSPEQETASPAMVEALNGVVPGTVKNQRGKVCVLSIDSGGMRG
IIPGKALAYLEHALKSKSGDPNARIADYFDVASGSGIGGIFTAMLFASSDGNRPIFKAED
TWRFLAMKGKSFYNKSPPGILNRVMKTGSGGSGGSGSKLEKAMKESFEELTLKDTLKPVL
IPCYDLTSSAPFLFSRADALETDGYDFKLWEVCRATWAEPGVFEPVEMRSVDGKTRCVAV
DGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDLLVLSLGTGQLVDVKYDCDKVMKWKAKH
WARPAVRISADGAADTVDQAVSMAFGQCRRSNYVRIQANGSSFGPCKPNIDTDASPSNVN
MLVGVAEEMLKQKNAESVLFGGKKINEESNYEKLDWLAGELVLEHQRRSCRIAPTVAFKQ
SGDRRVDQQTIFKDIDCMF

MHRVRNKPVKSTATASVKHLIKQRGGDGATAASKSANDYNNNDSLLTDMQEPSIDTDKLS
YEIFSILESKFLFGYDDSKPEPANSVVAGSIKNQRGKICILSIDGGGMRGILPGKALAYL
EHALKSKSGDPNARIADYFDVAAGSGIGGIYTAMLFGSRDGNRPIFKADDTWQFLTRNAK
GLYGGAGILKRVLRTGSGCCSGTAKLKKVMKESFSELTLKDTLKPVLIPCYDLKSSGPFL
FSRADALETDGYDFRLSEVCRATWAEPGVFEPVEMKSVDGQTKCVAVGGGLAMSNPTAAA
ITHVLHNKQEFPFVRGVEDLLVLSLGMGQLLDVSYEYDRIIKWKAKHWARPAALISNDGA
ADTVDQAVAMAFGHCRSSNYVRIQANGSNLGPWSPNMDTDPSGSNVNMLMGVAEEMLKQK
NVESVLFGGKRIDEQSNFEKLDWLAGELVLEHQRRNSRIAPTVAFKQSVHRADQKTSDKD
IGVTARER

www.000webhost.com

Other information
Ka divergence:-0.0257865KaKs divergence:0.305353
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1500Length 2 (bp):1467Length divergence:-0.011
MFE 1 (kcal):-478.06MFE 2 (kcal):-507.2MFE divergence0.03