Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39230-AT3G54980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LATERAL ORGAN JUNCTION
Function (paralog2):Pentatricopeptide repeat (PPR) superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.0564353269086
Log2 mRNA fold difference:2.7798068447241
Log2 TE fold difference:-0.62005577320722
Sequences
Protein sequence

MTTFMVSKRFRPPIFLHRFINPKPISSQTRFLHPPDNQSRDISDSTTETISTLEFPHKTS
VPNHSPLTSTSETENHVDDARVIEVLLGRRNDPVSALQYCNWVKPLHRLCEGGDVFWVLI
HILLSSIHTHDRASNLLVMFVSNNPTLIPNVMVNNLVDSSKRFGFELTPRAFNYLLNAYI
RNKRMDYAVDCFGLMVDRKVVPFVPYVNNVLSSLVRSNLIDEAKEIYNKMVLIGVAGDNV
TTQLLMRASLRERKPEEAVKIFRRVMSRGAEPDGLLFSLAVQAACKTPDLVMALDLLREM
RGKLGVPASQETYTSVIVAFVKEGNMEEAVRVMDEMVGFGIPMSVIAATSLVNGYCKGNE
LGKALDLFNRMEEEGLAPDKVMFSVMVEWFCKNMEMEKAIEFYMRMKSVRIAPSSVLVHT
MIQGCLKAESPEAALEIFNDSFESWIAHGFMCNKIFLLFCKQGKVDAATSFLKMMEQKGI
EPNVVFYNNMMLAHCRMKNMDLARSIFSEMLEKGLEPNNFTYSILIDGFFKNKDEQNAWD
VINQMNASNFEANEVIYNTIINGLCKVGQTSKAKEMLQNLIKEKRYSMSCTSYNSIIDGF
VKVGDTDSAVETYREMSENGKSPNVVTFTSLINGFCKSNRMDLALEMTHEMKSMELKLDL
PAYGALIDGFCKKNDMKTAYTLFSELPELGLMPNVSVYNSLISGFRNLGKMDAAIDLYKK
MVNDGISCDLFTYTTMIDGLLKDGNINLASDLYSELLDLGIVPDEILHMVLVNGLSKKGQ
FLKASKMLEEMKKKDVTPNVLLYSTVIAGHHREGNLNEAFRLHDEMLEKGIVHDDTVFNL
LVSGRVEKPPAASKISSLASPEMRSSY

MRSLLVFRKIPSRIRLRNLRNNKPFCSQSQFPKESENPSQEQRLLVYGSTSEENPVTSKV
SLLSAKPEQKDDASVIDVLLNRRNNPEAALRFYNWARPWRGSFEDGDVFWVLIHILVSSP
ETYGRASDLLIRYVSTSNPTPMASVLVSKLVDSAKSFGFEVNSRAFNYLLNAYSKDRQTD
HAVDIVNQMLELDVIPFFPYVNRTLSALVQRNSLTEAKELYSRMVAIGVDGDNVTTQLLM
RASLREEKPAEALEVLSRAIERGAEPDSLLYSLAVQACCKTLDLAMANSLLREMKEKKLC
VPSQETYTSVILASVKQGNMDDAIRLKDEMLSDGISMNVVAATSLITGHCKNNDLVSALV
LFDKMEKEGPSPNSVTFSVLIEWFRKNGEMEKALEFYKKMEVLGLTPSVFHVHTIIQGWL
KGQKHEEALKLFDESFETGLANVFVCNTILSWLCKQGKTDEATELLSKMESRGIGPNVVS
YNNVMLGHCRQKNMDLARIVFSNILEKGLKPNNYTYSILIDGCFRNHDEQNALEVVNHMT
SSNIEVNGVVYQTIINGLCKVGQTSKARELLANMIEEKRLCVSCMSYNSIIDGFFKEGEM
DSAVAAYEEMCGNGISPNVITYTSLMNGLCKNNRMDQALEMRDEMKNKGVKLDIPAYGAL
IDGFCKRSNMESASALFSELLEEGLNPSQPIYNSLISGFRNLGNMVAALDLYKKMLKDGL
RCDLGTYTTLIDGLLKDGNLILASELYTEMQAVGLVPDEIIYTVIVNGLSKKGQFVKVVK
MFEEMKKNNVTPNVLIYNAVIAGHYREGNLDEAFRLHDEMLDKGILPDGATFDILVSGQV
GNLQPVRAASL

www.000webhost.com

Other information
Ka divergence:-0.0365704KaKs divergence:-0.0258169
GC content 1 (%):39GC content 2 (%):40GC content divergence:0.013
Length 1 (bp):2604Length 2 (bp):2556Length divergence:-0.009
MFE 1 (kcal):-730.88MFE 2 (kcal):-730.03MFE divergence-0.001