Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39280-AT3G55020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ypt/Rab-GAP domain of gyp1p superfamily protein
Function (paralog2):Ypt/Rab-GAP domain of gyp1p superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.148747617852
Log2 mRNA fold difference:0.64901111159459
Log2 TE fold difference:0.51137055222783
Sequences
Protein sequence

MIADAVSKSDHKRYRLSSFSIATLLISLLLREVNEVGFMNRDAYGFSVRPQHVQRYREYV
NIYKEEEVERSARWSNFLEFHAESGVSPTNGSSENTHVNPSESDKKKEKELNKGAERKDL
NADKPGSDLTPGNAREEDEVPNREKNVHKVQLWAEIRPSLQAIEDLMSVRVKMKGDSTNG
EQEAQKLNSLASTDETESSKGVCENDSEDEFYDAERSDPIQDGSSDGTSVSSMSAAADAA
SLVSACPWKDELEVLIHGGAPMALRGELWQAFAGVKKRRVKNYYQNLLAADSLGNDIEQE
LMQHTDEKGSSTDPLSVVEKWKGQIEKDLPRTFPGHPALDDDFRNALRRLLTAYARHNPS
VGYCQAMNFFAALLLLLMPEENAFWSLTGIIDDYFHDYYSEEMLESQVDQRVLEELLRER
FPKLVHHLDYLGVQVACVTGPWFLTIFINMLPWESVLRVWDVLLFEGNRVMLFRTALALM
EFYGPALVTTKDIGDAVTLLQSMTGSTFDSSQLVFTACMGYQNVHESKLQELRSKHRPAV
IAAFEERLKGLQAWRDSKDTATKLHNSKQDPNSVLASKASLSNGSLSRSESGSSYADDIF
ISLTGDCEIDIFQDLQGQGELHKLLQEKRSALLRAEELEVALMEMVKQDNRRQLKAKIEQ
LEQGVTELRRLVSDKREQESAMIQVLMRMEQEHKVTEDARRLAEQDAATQRYAAEVLQEK
YEEAVAALAEMEERAVMAESMLEATLQYQSGQVKAQPSPRQLKQDLPVMVSP

MRSVAAAAAAAAAASKPSNPLVAFEHKRDAYGFPVRPQHVQRYREYADIYKEEEEERSDR
WSSFLEDHVESTELPTNGSSENIHAPFSESEKEKEKELNKGPGEDLHTDKLGSDVTPDNA
SEEEGHPDAEKNVHRVQLWTEIRPSLRSIEDLMSIRVKKKGDLSKSEQEAPKVKISPSFD
DAKSSKGASDIDSEDEFYDVERSDVQDGSSSDGTGVSGIPVAADASPLSTCPWKEELEVL
IRGGVPMALRGELWQAFVGVRKRRCKDYYQNLLAADGSVNTIEQEDMQHVDDKGSSTESI
AVVEKWKGQIEKDLPRTFPGHPALDDDGRNALRRLLTAYARHNPSVGYCQAMNFFAALLL
LLMPEENAFWALIGLIDDYFNGYYSEEMIESQVDQLVLEELVRERFPKLVHHLDYLGVQV
AWVTGPWFLSIFMNMLPWESVLRVWDVLLFEGTRVMLFRTALALMELYGPALVTTKDAGD
AVTLLQSLTGSTFDSSQLVLTACMGYQNVHEIRLQELRSKHRPAVIAALEERSKGLQAWR
DSKGLASKLYNFKQDPKSVLVDSKASLSNGSLSRSESGSSNADEVLVSLTGDGEVDSVQD
LQAQVLWLKAELCKLLEEKRSALLRAEELEIALMEIVKEDNRRQLSAKVEQLEQEMAEVQ
RLLSDKQEQEGAMLQVLMRVEQEQKVTEDARIFAEQDAEAQRYAAQVLQEKYEEAVAALA
EMEKRAVMAESMLEATLQYQSGQLKAQPSPRTSSKQDQFASTAIWTRVARQEQEHNT

www.000webhost.com

Other information
Ka divergence:-0.537772KaKs divergence:-0.323116
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2319Length 2 (bp):2334Length divergence:0.003
MFE 1 (kcal):-724.61MFE 2 (kcal):-735MFE divergence0.007