Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39290-AT3G55030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphatidylglycerolphosphate synthase 1
Function (paralog2):phosphatidylglycerolphosphate synthase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.31083675939351
Log2 mRNA fold difference:0.87919149895136
Log2 TE fold difference:-1.2628999251919
Sequences
Protein sequence

MLRSGLASLIVDVNLRRTLRPSPTFSFPAHLSRCIITSRYSSRTSLRFPIQISRHQHRLS
YFSSSSSSEQSRPTSSSRNSFSGHGQLDSDDNSSPPPSQSSSKVLTLPTVLTLGRVAAVP
LLVATFYVDSWWGTTATTSIFIAAAITDWLDGYLARKMRLGSAFGAFLDPVADKLMVAAT
LILLCTKPIQVAELGPLPWLLTVPSIAIIGREITMSAVREWAASQNGKLLEAVAVNNLGK
WKTATQMTALTILLASRDSNVGWLVASGAGLLYVSAGLSVWSLAVYMRKIWKVLMK

MGEEDTATVDQNSFGGGKDSLLRNRHSSPLPSPTQLSSKVITLPTVLTLGRVAAVPILVA
TFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGSEFGAFLDPVADKLMVAATLILL
CTKPMVAVVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTA
TQMIALTILLASRDSSFERLLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLLKK

www.000webhost.com

Other information
Ka divergence:0.340864KaKs divergence:-0.178562
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):891Length 2 (bp):702Length divergence:-0.119
MFE 1 (kcal):-248.3MFE 2 (kcal):-225.51MFE divergence-0.048