Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39300-AT3G55060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.5041039827008
Log2 mRNA fold difference:-0.16318126602046
Log2 TE fold difference:-0.29787378297608
Sequences
Protein sequence

MKKLFFFKSSSGNGTDHNKQLHKQKDDHFQRYLNSPKGLNKSQSEVSGAALRRSRSLSSA
AFVIDGTSSNQHRLRNHSSRCLTPERQFKEYGSMSTCSSNVSSQVLDRYIDGEEHLERSK
QKSGSLHSSSLSGSRRRLPPRAQSPSPLSESGKDKRKSKGLRDASARSLARSVIERLSHN
TQGKSKALSYEPIRIQDVCGKILDSNSDVLANVVVPLTEEYEPVNEYYPDDQTELQYQQF
FLHGKDMCKEDDVSSELEKRYKEAEKRVKLLSEEMEEKKFLSDCDFDISSLVGDIRQMEE
ERVGLAFEVLSLLRSQMDERASTREDIRRVKNDWDLLLKRLEKEKTELQVQLETELDRRS
SEWTSKVESFKVEEKRLRERVRELAEHNVSLQREISTFHEKETERIDMIRHLDETVTELS
ATAEEMREENLFLMQNLSKLQESYTGSTDDLDYVRRNFEEKDMECKELHKSVTRLLRTCK
EQEKTIQGLRDGFSEEIKKQPSEHVDKKLQMEQLRLVGVELSLRKEVESMKLEAESLRRE
NNCLLNRVKGNGEEADIMTTFKLDNEMKMRVCHLQDQGISMLNESTQLCYKFLKIIKEKS
VNSGWSEQFLIESEMRVHGIRRGTESLKRSLQTVTSLLLEKSNEMASNSESSCSSAARPS
SRSVEKSLRAELRAETLVTSLLREKLYSKEQEIEQLHAEVAAGVRGNEVLQCEIQNVLDN
LSLNNHQLKDLKLQMVKKDENINRMEINLQEAAKELLTLPKVLEEREEMWKEVKECRKRN
MDLESEKEMLKKKVEKLEEDTLFKEGQITILKDTLGSRHFDLLLSSPEFSYNDFLVQ

MKKLFFFRSSGNGNDKQVNCEKEADSKMRTQASSQAEQEFDSPKSHGQVSGGLALRRSLS
WSSAGFLFDKFGETSKNELTTSATKSKDRRRNHSSRCFTPERQVRERQCKADKFQHDSSG
SSSSCSSNVSSKVLDRYIDGEEHLEPCKQKSNSSHSGVSESINRRRLPPRVQWTVPTSPS
DTFDEKRKSQSFREAKGTHLRYSSADCVDNGLRHGSPRSVARNVIERLSQTHGKSKGSNH
EPITIQDVYGGSLNRTFDSSSDIAANVSLAEHYEPVNEYYTQDYGGHQQNCIRSRNVYKC
MEDDLDSELEMKIKEAEKRAKLFSAELEQQRCLSDCDFDVSSLVGAIRKLEDERLHLAFE
NVNLLRSQIVERASAREEIRWLKSDWDLHIQRLEKEKSELQAGLEKELDRRSGEWTSKLE
KFQLEEKKLRERVRELAEHNVSLQRELSAFHENETENKDMITHLERRVAELTTTADKLHE
ENNYVKQTLSKLQESYAGATEDLDFLRRNFEEKDQECRELHKSVTKFFRTCKEQGKTIEG
LRDGVSEEVKKQPSEKLDQLVKKLQVEQVRLTGIELSLRREVESMKLETDSLRHENICLL
NRLKGNGQEIDITTLKLENELKMRVCYLQEQGLSMLNESSQLCYKLLKFIKGKLTQLPET
YQDKNSVKDGLSEQFMIESEMKVHGIRRGTENLKRSLQTVTSVVASNSESSSSNTGRPRE
QRNQSVEENLRAELSAETLITSLVREKLYSKEKEIEQLQAELAAAVRGNEILRCEVQSSL
DNLSVTTHELKDLKHQMLKKEESIRRLESNLQEAAKEMARLNALLSKVSNERGQIWSEYK
QYGEKNMLLNSENETLKGMVEKLEEKVLEKEGEITILQDTIGSKHLNLLSSPDFLV

www.000webhost.com

Other information
Ka divergence:-0.179408KaKs divergence:0.226187
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):2514Length 2 (bp):2691Length divergence:0.034
MFE 1 (kcal):-695.49MFE 2 (kcal):-742.28MFE divergence0.033