Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39350-AT3G55130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ABC-2 type transporter family protein
Function (paralog2):white-brown complex homolog 19

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.4063614387333
Log2 mRNA fold difference:2.0588187037687
Log2 TE fold difference:0.35479623262222
Sequences
Protein sequence

MARIVAANDDDSMELNTISSIHDSTLGQLLKNVSDVRKMAIGDETPVHESLNQDYNDGYM
RTVPFVLSFDNLTYNVSVRPKLDFRNLFPRRRTEDPEIAQTARPKTKTLLNNISGETRDG
EIMAVLGASGSGKSTLIDALANRIAKGSLKGTVKLNGETLQSRMLKVISAYVMQDDLLFP
MLTVEETLMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERR
RVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGL
LDRLIFLSRGHTVYSGSPASLPRFFTEFGSPIPENENRTEFALDLIRELEGSAGGTRGLI
EFNKKWQEMKKQSNRQPPLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVAHGGATTNT
TTLAVPAFANPMWIEIKTLSKRSMLNSRRQPELFGIRIASVVITGFILATVFWRLDNSPK
GVQERLGFFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSL
IFLSVAFAATTYWAVGLDGGLTGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYTIVV
AILAYFLLFSGFFINRNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDN
TPLGELPEVMKLKLLGTVSKSLGVTISSTTCLTTGSDILRQQGVVQLSKWNCLFITVAFG
FFFRILFYFTLLLGSKNKRR

MNLSLSGRKIAMTRVSAETQYITPIGSPTLDELLKDCDSFRKGDSGDGVKSDDPAHHIID
VEALYVKPVPYVLNFNNLQYDVTLRRRFGFSRQNGVKTLLDDVSGEASDGDILAVLGASG
AGKSTLIDALAGRVAEGSLRGSVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTVKETLM
FASEFRLPRSLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDII
HDPIVLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSR
GKSVFNGSPASLPGFFSDFGRPIPEKENISEFALDLVRELEGSNEGTKALVDFNEKWQQN
KISLIQSAPQTNKLDQDRSLSLKEAINASVSRGKLVSGSSRSNPTSMETVSSYANPSLFE
TFILAKRYMKNWIRMPELVGTRIATVMVTGCLLATVYWKLDHTPRGAQERLTLFAFVVPT
MFYCCLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLLAPSLVFSAITFWTV
GLSGGLEGFVFYCLLIYASFWSGSSVVTFISGVVPNIMLCYMVSITYLAYCLLLSGFYVN
RDRIPFYWTWFHYISILKYPYEAVLINEFDDPSRCFVRGVQVFDSTLLGGVSDSGKVKLL
ETLSKSLRTKITESTCLRTGSDLLAQQGITQLSKWDCLWITFASGLFFRILFYFALLFGS
RNKRT

Other information
Ka divergence:0.373623KaKs divergence:0.328794
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2223Length 2 (bp):2178Length divergence:-0.01
MFE 1 (kcal):-692.47MFE 2 (kcal):-688.34MFE divergence-0.003