Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39380-AT3G55150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):exocyst subunit exo70 family protein H2
Function (paralog2):exocyst subunit exo70 family protein H1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.37518703126952
Log2 mRNA fold difference:-1.0148036498495
Log2 TE fold difference:0.58788755772886
Sequences
Protein sequence

MSKKPKSVHFSTSSPKSFLSSFPSFTSLPASPLNQTFSQSMMEETVEAAESIIKKWDPNS
PSYTKIISLFSHSRREAKEFIRCIRDLRRAMHFLISQHSKSAKLVLAQHLMQIAMARLEK
EFFQILSSNRDQLDPESVSGHSSISSNSEFEDVMQSSDDEEEDELKKAGETITKVEKAAA
LVMSDLKVIAETMISCGYGKECIKSYKLIRKSIVDEGLHLLGIEKCKISRFNRMDWDVLE
HMIKNWIKAAKIGVITLLRGEKLLCDHVFSASSTIRESCFYEIVNEAGINLFKFPELVAE
KKPSPERIFRLMDLYAAISDLRPDIELIFHFDSVAAVKTLVLSSLKKLKDSIYTSLMEFE
STIQKDSSKALTAGGGIHKLTRSTMSFISSLSEYSRVLSEILAEHPLKKNTRMLESYFTA
PILEDEHNNHAVSVHLAWLILIFLCKLDIKAESYKDVSLSYLFLVNNIQFVVDTVRSTHL
RNLLGDDWLTKHEAKLRSYAANYEIAAWANVYISLPEKTSSRLSPEEAKTHFKRFHAVFE
EAYMKQSSCVITDAKLRNELKVSIAKKIVPEYREFYGKYLPTLSKERNIEMLVSFKPDNL
ENYLSDLFHGTPILSGSSSSSSSLSSSSCISLGCVRN

MAKMAKFSFFSSSSPKYHPSSPSSFTSFPASPLNQNFTQAMMEETVETADSVIRKWDPNT
PSFTKIVSLFNHSRKEAKEFIRCVRDLRRAMHFLVSQDSQSPKLALAQTLMQIAMARLEK
EFFQILSSNRDKLDPESVSGQSSISSNSEFEDVMGSDDDDESDNEMRKAGESITQVEKAS
AMVMSDLKAIAESMISCGYGKECVKIYKRVRKSIVDEGLSLLGIEIYKGSRFHRTDWVTL
EHMIKNWIKAAKIGIATLFRGEKLLCDHVFSASNSTRESCFYEIANEAATNLFKFPEFVA
KEKKSHERIFPLMDLQAAISDLWQDIEMIFHFDAVAGVKSQALTSLQKLKVSIHSALTDF
ESIIQKDTTKALTPGGGIHKLTRSTMNFISSLSKYSGVLSEILADHPLPRNTRLLESYVR
APISEDEQHNHALSVHFAWLILVLLCKLDTKAEHYKDVSLSYLFLANNLQIIIETVGSTP
LRNLLGDDWLNKHEDKLCAYAGNYEIAAWSNVFMSLPEEPTDLSPEEAKIYFRRFHTAFE
EAYMKQSSRVVPNAKLRDELKVSIAKKLVPEYREFYRKYLPMLGQERNIEILVRFKPDNL
ENYISDLFHGTPIHASSSFSSSSSSSSWKSLGCVSG

www.000webhost.com

Other information
Ka divergence:0.0839502KaKs divergence:0.122342
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1914Length 2 (bp):1911Length divergence:-0.001
MFE 1 (kcal):-519.24MFE 2 (kcal):-542.63MFE divergence0.022