Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39430-AT3G55230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Disease resistance-responsive (dirigent-like protein) family protein
Function (paralog2):Disease resistance-responsive (dirigent-like protein) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.2056341630073
Log2 mRNA fold difference:0.42223846763745
Log2 TE fold difference:0.81552447967916
Sequences
Protein sequence

MAKALHITIFLFLISSNLLAFINSARLLDEIQPQPQLVPTGQIPTVAPTEAEEEDGTDDN
PGLATTTTTASAVTVPAGPAEATEPLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFS
KASNSIFPVDNGVPLVNSNNINSVINPNTAPLLTGLGGAQTSTVIQNTNGNSNDALSANS
LPFVTAGNLPPGAALQHLMFGTITVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTL
SLTVLLHGEHDQHDTLDDAISFFGVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQD
NQHITDGQDTILHFSVYLTYKA

MAKALSLTIFLFLLIASNVQSARLLDEVQTQPQLVPQVPEEEDDSPQAVTTTPTPIPLPG
PATGGPEPILEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKSSNNIFPVDNAVPLVN
ANSINNLINPNTAPLLTGLSGSQANTVIQNSNGNSQGSLSSNNLPFVTTGQLPPIAALQQ
LMFGSITVVDDELTEGHELGSAIIGRAQGFYLASSLDGTSQTLSLTVLLHEDHDHHDTLD
DAISFFGVHRTASHASHIAVVGGTGRFEHAKGYAVVETLHNQEDQHVTDGHDTILHFSVY
LTYYKA

www.000webhost.com

Other information
Ka divergence:-0.0368667KaKs divergence:-0.153449
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):969Length 2 (bp):921Length divergence:-0.025
MFE 1 (kcal):-280.89MFE 2 (kcal):-276.46MFE divergence-0.008