Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39480-AT3G55320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-glycoprotein 6
Function (paralog2):P-glycoprotein 20

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.7107272060246
Log2 mRNA fold difference:0.15624724315329
Log2 TE fold difference:1.5294526914995
Sequences
Protein sequence

MMISRGLFGWSPPHIQPLTPVSEVSEPPESPSPYLDPGAEHGGTGTAAQADDEEEMEEPE
EMEPPPAAVPFSQLFACADRFDWVLMVFGSVAAAAHGTALIVYLHYFAKIVQVLAFPTDS
DHLISDDQFNRLLELSLTIVYIAGGVFISGWIEVSCWILTGERQTAVIRSKYVQVLLNQD
MSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFISGLIIGFVNCWEIALIT
LATGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYVRTLYAFTNETLAKYSYA
TSLQATLRYGILISLVQGLGLGFTYGLAICSCAMQLWIGRFFVIHHRANGGEIITALFAV
ILSGLGLNQAATNFYSFDQGRIAAYRLFEMISRSSSGTNQEGIILSAVQGNIEFRNVYFS
YLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKN
LKLEWLRSQIGLVTQEPALLSLSIRENIAYGRDATLDQIEEAAKKAHAHTFISSLEKGYE
TQVGKTGLTLTEEQKIKLSIARAVLLDPTILLLDEVTGGLDFEAERVVQEALDLLMLGRS
TIIIARRLSLIRNADYIAVMEEGQLLEMGTHDELINLGNLYAELLKCEEATKLPRRMPVR
NYNDSAAFQAERDSSAGRGFQEPSSPKMAKSPSLQRGHNVFRSQELCFNSEESPNDHSPA
PEKLGENGSSLDVGEKEPTIKRQDSFEMRLPELPKIDIQCPQRQKSNGSDPESPISPLLI
SDPQNERSHSQTFSRPLGHSDDTSASVKVAKDGQHKEPPSFWRLAQLSFPEWLYAVLGSI
GAAIFGSFNPLLAYVIALVVTTYYTSKGSHLREEVDKWCLIIACMGIVTVVANFLQHFYF
GIMGEKMTERVRRMMFSAMLRNEVGWYDEEENSPDTLSMRLANDATFVRAAFSNRLSIFI
QDSFAVIVAILIGLLLGWRLALVALATLPVLTLSAIAQKLWLAGFSKGIQEMHRKASLVL
EDAVRNIYTVVAFCAGNKVMELYRLQLQRILRQSFFHGMAIGFAFGFSQFLLFACNALLL
WYTALSVDRRYMKLSTALTEYMVFSFATFALVEPFGLAPYILKRRRSLASVFEIIDRVPT
IEPDDTSALSPPNVYGSIELKNIDFCYPTRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKS
TIISLIERYYDPVAGQVLLDGRDLKSYNLRWLRSHMGLIQQEPIIFSTTIRENIIYARHN
ASEAEMKEAARIANAHHFISSLPHGYDTHIGMRGVELTQGQKQRIAIARVVLKNAPILLI
DEASSSIESESSRVVQEALDTLIMGNKTTILIAHRVAMMRHVDNIVVLNGGKIVEEGTHD
CLAGKNGLYVRLMQPHFGKNLRRHQLI

MMISRGLFGWSPPHMQPLTPVSEVSEPPESPSPYLDPGAESGGGTGTAAALAEADEEMDD
QDELEPPPAAVPFSQLFACADRFDWVLMIVGSVAAAAHGTALIVYLHYFAKIVDVLAFSN
DSSQQRSEHQFDRLVQLSLTIVYIAGGVFISGWIEVSCWILTGERQTAVIRSKYVQVLLN
QDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFISGLVIGFVNCWEIAL
ITLATGPFIVAAGGISNIFLHRLAENIQDAYAEAAGIAEQAISYIRTLYAFTNETLAKYS
YATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWIGRFFVHNGRANGGEIIAALF
AVILSGLGLNQAATNFYSFDQGRIAAYRLFEMITRSSSVANQEGAVLASVQGNIEFRNVY
FSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENI
KNLKLEWLRSQIGLVTQEPALLSLSIRENIAYGRDATLDQIEEAAKNAHAHTFISSLEKG
YETQVGRAGLAMTEEQKIKLSIARAVLLNPTILLLDEVTGGLDFEAERIVQEALDLLMLG
RSTIIIARRLSLIKNADYIAVMEEGQLVEMGTHDELINLGGLYAELLKCEEATKLPRRMP
VRNYKESAVFEVERDSSAGCGVQEPSSPKMIKSPSLQRGSGVFRPQELCFDTEESPKAHS
PASEKTGEDGMSLDCADKEPTIKRQDSFEMRLPHLPKVDVQCPQQKSNGSEPESPVSPLL
TSDPKNERSHSQTFSRPLSSPDDTKANGKASKDAQHKESPSFWRLAQLSFPEWLYAVLGS
LGAAIFGSFNPLLAYVIALVVTEYYKSKGGHLREEVDKWCLIIACMGIVTVVANFLQHFY
FGIMGEKMTERVRRMMFSAMLRNEVGWFDDEENSPDTLSMRLANDATFVRAAFSNRLSIF
IQDSFAVIVALLIGLLLGWRLALVALATLPILTLSAIAQKLWLAGFSKGIQEMHRKASLV
LEDAVRNIYTVVAFCAGNKVMELYRMQLQRILRQSYLHGMAIGFAFGFSQFLLFACNALL
LWCTALSVNRGYMKLSTAITEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIVDRVP
TIEPDDNSALKPPNVYGSIELKNVDFCYPTRPEILVLSNFSLKISGGQTVAVVGVSGSGK
STIISLVERYYDPVAGQVLLDGRDLKLYNLRWLRSHMGLVQQEPIIFSTTIRENIIYARH
NASEAEMKEAARIANAHHFISSLPHGYDTHIGMRGVELTPGQKQRIAIARVVLKNAPIIL
IDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTH
DSLAAKNGLYVRLMQPHFGKGLRQHRLI

www.000webhost.com

Other information
Ka divergence:-0.0507149KaKs divergence:-0.00619579
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):4224Length 2 (bp):4227Length divergence:0
MFE 1 (kcal):-1304.04MFE 2 (kcal):-1320.61MFE divergence0.006