Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39518-AT2G39530
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Uncharacterised protein family (UPF0497)
Function (paralog2):Uncharacterised protein family (UPF0497)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.30830913754784
Log2 mRNA fold difference:0.11318204076419
Log2 TE fold difference:0.27241085212819
Sequences
Protein sequence

MAPPPPSPPAVSLKVLLLLLRVLTGVFLVIALIILSTNSVTIVSQGSALKFHFKDVYAYR
YMLSAAVIGLVYAVIQLFFTISEFATGVKNPFNYQLDFYGDKLISYLVATGSAAGFGVTK
DLKDTFLALVALDSTDPVDKFFSKGYASASLLLFAFICLAVLSVFSSFAMAKRN

MAPPPPAPPSVTLRTVLLLLRVLTAAFLLITVVLISTNTVTLEISSTSIKLPFNDVYAYR
YMLSAAVIGLVYAVVQLFLTISQFATGKTHPLTYQFDFYGDKVISYLLATGSAAGFGVSK
DLKDTYIALIEFDSTDPVDKFFSKGYASASLLLFAFVSLAVLSVFSSLALSKRPVPVS

www.000webhost.com

Other information
Ka divergence:-0.0604717KaKs divergence:0.365722
GC content 1 (%):41GC content 2 (%):45GC content divergence:0.047
Length 1 (bp):525Length 2 (bp):537Length divergence:0.011
MFE 1 (kcal):-130MFE 2 (kcal):-126.67MFE divergence-0.013