Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39640-AT3G55430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycosyl hydrolase family 17 protein
Function (paralog2):O-Glycosyl hydrolases family 17 protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:5.2307317086544
Log2 mRNA fold difference:3.4633233977659
Log2 TE fold difference:1.7925911193242
Sequences
Protein sequence

MAKTIRSFILPFLLIVAGVIFQLSAVTSAIGINYGTLGNLQPPQQVVDFIKTKTTFDSVK
IYDANPDILRAFAGSEINITIMVPNGNIPAMVNVANARQWVAANVLPFQQQIKFKYVCVG
NEILASNDNNLISNLVPAMQSLNEALKASNLTYIKVTTPHAFTISYNRNTPSESRFTNDQ
KDIFTKILEFHRQAKSPFMINAYTFFTMDTNNVNYAIFGPSNAITDTNTQQTYTNMFDAV
MDATYSAMKALGYGDVDIAVGETGWPTACDASWCSPQNAENYNLNIIKRAQVIGTPLMPN
RHIDIFIFALFNEDGKPGPTRERNWGIFKPDFSPMYDVGVLKGGGSPLPFPPINNNGKWC
VGKPEATLMQLQANIDWVCSHGIDCTPISPGGICFDNNNMTTRSSFIMNAYYQSKGCVDV
VCDFSGTGIVTSTNPSTSTCPIPIGEGGGGNGAKSKSANWCMAKQEATETQLQANIDWVC
SQGIDCKPISPGGICFDNNNMKTRSTFIMNAYYESKGYSKDACDFRGSGIVTTTNPSTST
CVVPASVTL

MAKAPPSISLLLLLCAAVFLTIPAVISAIGVNYGTLGNLPPPTQVANFIKTQTSIDSVKI
FDVNPDILRAFAGTGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGN
EILLTGDNNMINNLLPAMRNLNNALVRAGVRDVKVTTAHSLNIIAYDLTGAPSSGRFRPG
WDKGILAPILAYHRRTKSPFMVNPYPYFGFDPKNVNFAIFRTPYKAVRDPFTRHVYTNMF
DALMDSTYSAMKALGYGDVNIVVGETGWPSACDAPWCSPANAAWFNLNIIKRAQGQGTPL
MPNRRFETYIFGLFNEEGKPGPTAERNWGLFRADFSPVYDVGLLRNGQGGGGRPALPAPS
TAGGKWCVARSGATNTQLQDSINWVCGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQ
SHGRTDGACNFSGTGMIVGNNPSNGACKY

www.000webhost.com

Other information
Ka divergence:-0.40638KaKs divergence:-0.544588
GC content 1 (%):44GC content 2 (%):51GC content divergence:0.074
Length 1 (bp):1650Length 2 (bp):1350Length divergence:-0.1
MFE 1 (kcal):-473.18MFE 2 (kcal):-443.72MFE divergence-0.032