Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39660-AT3G55450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):botrytis-induced kinase1
Function (paralog2):PBS1-like 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.32388821647684
Log2 mRNA fold difference:-0.35794265436158
Log2 TE fold difference:0.029919970641853
Sequences
Protein sequence

MGSCFSSRVKADIFHNGKSSDLYGLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFTFNEL
KLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLT
EINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNV
ALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVM
GTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTS
KRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNLGKPS
QTNPVKDTKKLGFKTGTTKSSEKRFTQKPFGRHLV

MGSCLSSRVLSTFSTILHLPFFFFFFFFPFFGVLSILTVVNAFVCCADKSSSGLDDLHLS
SCKSSSSATAHKTEGEILSSTTVKSFSFNELKLATRNFRSDSVVGEGGFGCVFRGWLDET
TLTPTKSSSGLVIAVKRLNPDGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEQRLLV
YEFMHKGSLENHLFANGNKDFKPLSWILRIKVALDAAKGLAFLHSDPVKVIYRDIKASNI
LLDSDFNAKLSDFGLARDGPMGEQSYVSTRVMGTFGYAAPEYVSTGHLNARSDVYSFGVV
LLELLCGRQALDHNRPAKEQNLVDWARPYLTSRRKVLLIVDTRLNSQYKPEGAVRLASIA
VQCLSFEPKSRPTMDQVVRALVQLQDSVVKPANVDPLKVKDTKKLVGLKTEDKYQRNGLN
KKTVGL

Other information
Ka divergence:0.146014KaKs divergence:0.213465
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1188Length 2 (bp):1281Length divergence:0.038
MFE 1 (kcal):-370.6MFE 2 (kcal):-384.81MFE divergence0.019