Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39700-AT3G55500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):expansin A4
Function (paralog2):expansin A16

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.78099423618689
Log2 mRNA fold difference:-0.99573568875653
Log2 TE fold difference:0.29156151135822
Sequences
Protein sequence

MAIKLAILFTTFVLFSLADARIPGIYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ
GYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDN
GGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLIT
NVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMV
PSNWQFGQTFVGKNFRV

MAINPLILLTIFPLFLLLSFTDAGIPRVFSGGSWQTAHATFYGGNDASGTMGGACGYGNL
YSQGYGTNTAALSTSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQP
SDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLV
LITNVAGAGDIARTSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSW
NIAPSNWQFGQTFVGKNFRV

www.000webhost.com

Other information
Ka divergence:0.22829KaKs divergence:0.237673
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):774Length 2 (bp):783Length divergence:0.006
MFE 1 (kcal):-255.11MFE 2 (kcal):-254.25MFE divergence-0.002