Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39770-AT3G55590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glucose-1-phosphate adenylyltransferase family protein
Function (paralog2):Glucose-1-phosphate adenylyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-7.1449779137169
Log2 mRNA fold difference:-6.8408029364547
Log2 TE fold difference:-0.27861643521765
Sequences
Protein sequence

MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM
LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLKE
MLEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGRVEKFVEKPKLYVGNKINAGIYLLN
PSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRKK
SPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKK
HACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILKPEIV
M

MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYEPEQL
LVMSKFSNDVEATLGIKITCSQETEPLGTAGPLALARDKLVDGSGQPFFVLNSDVISDYP
LEEMIAFHNAHGGEASIMVTKVDEPSKYGVVVMEEATGRVERFVEKPKLFVGNKINAGIY
LLNPSVLDRIELRPTSIEKEIFPQIAEAEKLYAMLLPGFWMDIGQPRDYITGLRLYLDSL
RKKSPSKLATGPHILGNVLVDETAEIGEGCLIGPNVAIGPGCVVESGVRLSHCTVMRGVH
VKRYACISSSIIGWHSTVGQWARVENMSILGKNVYVCDEIYCNGGVVLHNKEIKSDILKP
DIVM

www.000webhost.com

Other information
Ka divergence:0.327776KaKs divergence:-0.00833868
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1086Length 2 (bp):1095Length divergence:0.004
MFE 1 (kcal):-337.34MFE 2 (kcal):-349.17MFE divergence0.017