Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39870-AT3G55690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.5231440303191
Log2 mRNA fold difference:-1.5458623910294
Log2 TE fold difference:1.15324240212
Sequences
Protein sequence

MSRLLPPHLSVNLPTMEKTTSSELTPTRLGFPNEFPYEFDSPSFSPGFTSPGDSTETEDE
SSDDEEDFLAGLTRRLAPSTQRLPSPLFKSEEKRQVAATSPQSTLSGLGSFSNSGSRSPI
LPSPPAPTSSFRRDNAWDVISAAAGEVARLKLGSYEPHHLPLQTPESLLRRQNAAIHAEL
QHQRLIEQMWLCSAQSRFKLSENRIPRRVVNEEGLFENPRYVRRNNPTWLPPQQAAAPLK
RPSAGTGVFLPRRYPSAAPSDSLKTPVNTPAMLQPKVKPQNLNFDEFTNIVGPRRSQFDY
ECMLARSTVLARQGNFRAVSGGGLPQDWMY

MVAPPIAAASLELPPPFPAVFEQPMEKLTFPNEFPYEFASSTFSTSPEDSTETEDETTDD
EDDFLAGLTRRLALSTQRLSSPSFVTDKSQMKPKVTESTQSGLGSPNGPFSQVPSPPTSP
SREEDSLKVLSAAAGEVAKIKKANFDAKPISYPNPNPNYLTSFPQNVAYYNCYWLWEPHY
PQSQMGIVPNAWHIPPSPVRAFYTLPTAVKSPSTGTGVFLPRKYSNPSDSPKKKSGDGCV
KVVNQQKPKIEVLPVRCKPNSKAGLSTGRSKIDYVAGGGCLKHEKPLLQEWMY

www.000webhost.com

Other information
Ka divergence:0.0233515KaKs divergence:0.157537
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):993Length 2 (bp):882Length divergence:-0.059
MFE 1 (kcal):-310.72MFE 2 (kcal):-239.87MFE divergence-0.129