Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39880-AT3G55730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 25
Function (paralog2):myb domain protein 109

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.2203938791978
Log2 mRNA fold difference:2.0435073641664
Log2 TE fold difference:0.22767706802174
Sequences
Protein sequence

MNGEISRPPELISSRNPCKSFENAIHKAVEAELAELAKSDANGGGKSKVKGPWLPEQDEA
LTRLVKMCGPRNWNLISRGIPGRSGKSCRLRWCNQLDPILKRKPFSDEEEHMIMSAQAVL
GNKWSVIAKLLPGRTDNAIKNHWNSNLRRKPAEQWKIPLLMSNTEIVYQLYPSMVRRISN
ASPKEHLPQEEETGVLSDDKMDDEAKEPPREQNSKTGVYRPVARMGAFSVCKPGYMAPCE
GPLVQASRPDSLAGKFLQSLCYDPIIPSKCGHGCCNHQDSTTLSSSSVLGSEFVDYEEHS
SAELDKELISISNDLNNTAWIRSGKEAEQSLKADDQFRREYAHSKFSGMVNNGVSSQMVR
QDLRALS

MEGETHQSEPLPLASGDSDEGISAAIEAELAELAAGDSSGGGGCGGGGGGIRSKVKGPWS
TEEDAVLTKLVRKLGPRNWSLIARGIPGRSGKSCRLRWCNQLDPCLKRKPFSDEEDRMII
SAHAVHGNKWAVIAKLLTGRTDNAIKNHWNSTLRRKYADLWNNGQWMANSVTTASVKNEN
VDETTNPPSSKQQLPQGDINSSPPKPPQVSDVVMEEAANEPQEPQEQQEQAPPVVSNVPT
ENNVFRPVARVGAFSIYNPTSQKNGYRDYNIVPCEGPLIQAAKPDSLAGKFLQSLCDEPQ
IPSKCGHGCSTLPAETKFSRNSVLGPEFVDYEEPSAVFNQELISIATDLNNIAWIKSGLD
NAVVREAEQSLKMDNYNYNDPRIKFTGMMPRQDFFCARS

Other information
Ka divergence:-0.463928KaKs divergence:-0.258948
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1104Length 2 (bp):1200Length divergence:0.042
MFE 1 (kcal):-321.65MFE 2 (kcal):-351.06MFE divergence0.044