Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39890-AT3G55740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):proline transporter 1
Function (paralog2):proline transporter 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.901678907406
Log2 mRNA fold difference:-0.555871837308
Log2 TE fold difference:-0.39059193559342
Sequences
Protein sequence

MTATEAKNRKINVGDGDDVVDIEIPDTAHQISSDSWFQVAFVLTTGINSAYVLGYSGTIM
VPLGWIGGVVGLLIATAISLYANTLIAKLHEFGGRRHIRYRDLAGFIYGRKAYHLTWGLQ
YVNLFMINCGFIILAGSALKAVYVLFRDDHTMKLPHFIAIAGLICAIFAIGIPHLSALGV
WLGVSTFLSLIYIVVAIVLSVRDGVKTPSRDYEIQGSSLSKLFTITGAAANLVFAFNTGM
LPEIQATVRQPVVKNMMKALYFQFTAGVLPMYAVTFIGYWAYGSSTSTYLLNSVNGPLWV
KALANVSAILQSVISLHIFASPTYEYMDTKYGIKGNPFAIKNLLFRIMARGGYIAVSTLI
SALLPFLGDFMSLTGAVSTFPLTFILANHMYYKAKNNKLNAMQKLWHWLNVVFFSLMSVA
AAIAAVRLIAVDSKNFHVFADL

MDTSEARNRKVVAVEQFDLEVPETAHQISSDSWFQVAFVLTTGINSAYVLGYSGTVMVPL
GWIGGVVGLILATAISLYANTLIAKLHEFGGKRHIRYRDLAGFIYGKKMYRVTWGLQYVN
LFMINCGFIILAGSALKAVYVLFRDDSLMKLPHFIAIAGVVCAIFAIGIPHLSALGIWLG
VSTILSIIYIIVAIVLSAKDGVNKPERDYNIQGSSINKLFTITGAAANLVFAFNTGMLPE
IQATVKQPVVKNMMKALYFQFTVGVLPMYAVTFIGYWAYGSSTSTYLLNSVSGPVWVKAL
ANISAFLQSVISLHIFASPTYEYMDTKYGVKGSPLAMKNLLFRTVARGSYIAVSTLLSAL
LPFLGDFMSLTGAISTFPLTFILANHMYLVAMNDELSLVQKLWHWLNVCFFGLMSLAAAI
AAVRLISVDSKNFHVFADV

Other information
Ka divergence:0.102901KaKs divergence:-0.505732
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1329Length 2 (bp):1320Length divergence:-0.003
MFE 1 (kcal):-402.04MFE 2 (kcal):-386.06MFE divergence-0.02