Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G39900-AT3G55770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GATA type zinc finger transcription factor family protein
Function (paralog2):GATA type zinc finger transcription factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1108025289873
Log2 mRNA fold difference:2.260521192704
Log2 TE fold difference:-1.1480472596105
Sequences
Protein sequence

MSFTGTQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRP
HFEQLFKESGSFSKNFQSPAKPLTDKPTPELNRTPSRLAGMFSGTQDKCATCTKTVYPIE
KVTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASI
KRATAAATAAAAAVAAVPES

MSFTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKP
HFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEK
IHNPLSYRELARKPNVLHRCIDPGDIGSCYFNLHVTVESQTYHKSCFKCSHGGCPISPSN
YAALEGILYCKHHFAQLFKEKGSYNHLIKSASIKRSAAAAVAAGVPAASVPES

www.000webhost.com

Other information
Ka divergence:-0.381723KaKs divergence:-0.462154
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):603Length 2 (bp):702Length divergence:0.076
MFE 1 (kcal):-184.7MFE 2 (kcal):-214.73MFE divergence0.075