Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40000-AT3G55840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ortholog of sugar beet HS1 PRO-1 2
Function (paralog2):Hs1pro-1 protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-5.2625801803185
Log2 mRNA fold difference:-4.1394313938162
Log2 TE fold difference:-0.83808055167014
Sequences
Protein sequence

MVDMDWKRKMVSSDLPNSPKLSSKLHVTIPSPFKIVPVSSPISCSAPALCSAYELYLRLP
ELRKLWSSRDFPQWTSEPILKPALQALEISFRLVFAVCSDTRPYINHREWNRRLDSLITK
QIQLVAAICEDEEEEGISAEAPVGGGRSSLSLLPQLATWRRSEALGKKILYTIDNEMSRC
KYTLGLGEQNIAGKPNLRYDAICRPNEIYSLKDNPYADHIDNHENQTLYIIHQILESWIY
ASGNLLNRIVSSIEEEKFGKASNDVYLLEKIWKILAEIEDLHMLMDPEDFLKLKKQLQIK
STGKNDAFCFRSKGLVEMMKMSKDLRQKVPAVLAVEVDPTGGPRLQEAAMKLYARKTECD
KIHLLQGMQAVEAAAKSFFFGYRQLVAAMMGSAEMNATASQESCDSLSQIFMEPTYFPSL
DAAKTFLGEFWSHLG

MADLDLQRKMVSPKLHVTIPEPCKLSSVSSPISSSSSAACSAYELYLRLPELRNLWSSLY
FPHWISEPVLKPALQALEITFRLILTVASDTRPYINRREWIRRLDSLTTSQIKIVAAICG
DEDNYEENVSAAPVSNGWSSLSLLSEIATCRTSESVGQKILSTIENEMRWCKYTLGLGEP
NLAGKPYLQYDAVCLPEELHSLKNNPYADHIENQENQMLYTSHQILESWIYVSVNLLYRI
ESRIEEGKFEKASSDVYLLERIWKLLSEIEDLHILMDPEDFLKVKKQLQIKSTFPNDAFC
FRSKGLVEMAKMSKELRQKVPAVLEVEVDPTGGPRLQEAAMKLYSRKTEYEKIHLLQGMQ
AVESAAKRFFFGYQKLVAAMIGNAEANANRTVANHESYDSLTQVFMEPPYYPSLDAAKTF
LGEFWSQL

www.000webhost.com

Other information
Ka divergence:0.237672KaKs divergence:0.175724
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1308Length 2 (bp):1287Length divergence:-0.008
MFE 1 (kcal):-412.8MFE 2 (kcal):-413.54MFE divergence0.001