Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40110-AT3G55890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Yippee family putative zinc-binding protein
Function (paralog2):Yippee family putative zinc-binding protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.5221120324376
Log2 mRNA fold difference:-2.8660991901873
Log2 TE fold difference:-0.62672875691441
Sequences
Protein sequence

MGRLFVVNLEGKIYSCKHCKTHLATYEDIISKSFHCKHGKAYLFNKVANVSIGETEERLM
MTGKHTVADIFCVSCGSIVGWKYETAHEKNQKYKEGKSVLERFKISGPDGSNYWVSSHGR
HIGGSDADDA

MGRVFMVDLEGNIYICKLCKTHLSTDQDIMSKSFQCKNGRAYLFNNVVNVSVGEKEDRMM
ITGLHNVVDIFCVGCGSNVGWKYEFAHEKSQKYKEGKSVLELYKISGPHDSNDLVSDGDD
A

Other information
Ka divergence:0.616508KaKs divergence:-0.0868959
GC content 1 (%):42GC content 2 (%):39GC content divergence:-0.037
Length 1 (bp):393Length 2 (bp):366Length divergence:-0.036
MFE 1 (kcal):-108.96MFE 2 (kcal):-98.6MFE divergence-0.05