Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40140-AT3G55980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc finger (CCCH-type) family protein
Function (paralog2):salt-inducible zinc finger 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.1290551361467
Log2 mRNA fold difference:-0.050727786597897
Log2 TE fold difference:-0.037762967409126
Sequences
Protein sequence

MCGAKSNLCSSKTLTEVEFMRQKSEDGASATCLLEFAACDDLSSFKREIEENPSVEIDES
GFWYCRRVGSKKMGFEERTPLMVAAMYGSMEVLNYIIATGRSDVNRVCSDEKVTALHCAV
SGCSVSIVEIIKILLDASASPNCVDANGNKPVDLLAKDSRFVPNQSRKAVEVLLTGIHGS
VMEEEEEELKSVVTKYPADASLPDINEGVYGTDDFRMFSFKVKPCSRAYSHDWTECPFVH
PGENARRRDPRKYPYTCVPCPEFRKGSCPKGDSCEYAHGVFESWLHPAQYRTRLCKDETG
CARRVCFFAHRRDELRPVNASTGSAMVSPRSSNQSPEMSVMSPLTLGSSPMNSPMANGVP
LSPRNGGLWQNRVNSLTPPPLQLNGSRLKSTLSARDMDMEMELRFRGLDNRRLGDLKPSN
LEETFGSYDSASVMQLQSPSRHSQMNHYPSSPVRQPPPHGFESSAAMAAAVMNARSSAFA
KRSLSFKPAPVASNVSDWGSPNGKLEWGMQRDELNKLRRSASFGIHGNNNNSVSRPARDY
SDEPDVSWVNSLVKENAPERVNERVGNTVNGAASRDKFKLPSWAEQMYIDHEQQIVA

MCSGPKSNLCSSRTLTEIESRQKEEETMLLLEFAACDDLDSFKREVEEKGLDLDESGLWY
CRRVGSKKMGLEERTPLMVAAMYGSIKVLTFIVSTGKSDVNRACGEERVTPLHCAVAGCS
VNMIEVINVLLDASALVNSVDANGNQPLDVFVRVSRFVASPRRKAVELLLRGGGVGGLID
EAVEEEIKIVSKYPADASLPDINEGVYGSDEFRMYSFKVKPCSRAYSHDWTECAFVHPGE
NARRRDPRKYPYTCVPCPEFRKGSCPKGDSCEYAHGVFESWLHPAQYKTRLCKDETGCAR
KVCFFAHKREEMRPVNASTGSAVAQSPFSSLEMMPGLSPLAYSSGVSTPPVSPMANGVPS
SPRNGGSWQNRVNTLTPPALQLNGGSRLKSTLSARDIDMEMEMELRLRGFGNNVEETFGS
YVSSPSRNSQMGQNMNQHYPSSPVRQPPSQHGFESSAAAAVAVMKARSTAFAKRSLSFKP
ATQAAPQSNLSDWGSPNGKLEWGMKGEELNKMRRSVSFGIHGNNNNNAARDYRDEPDVSW
VNSLVKDSTVVSERSFGMNERVRIMSWAEQMYREKEQTVV

www.000webhost.com

Other information
Ka divergence:0.0894685KaKs divergence:0.193871
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1794Length 2 (bp):1743Length divergence:-0.014
MFE 1 (kcal):-599.31MFE 2 (kcal):-574.79MFE divergence-0.021