Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40150-AT2G40160
Species:Arabidopsis
Duplication type:TD
Function (paralog1):TRICHOME BIREFRINGENCE-LIKE 28
Function (paralog2):Plant protein of unknown function (DUF828)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6834153497377
Log2 mRNA fold difference:-0.20363884391684
Log2 TE fold difference:-1.5779575787656
Sequences
Protein sequence

MQPSRTRVSFFETGETMKQRKKSYLSIFVIFFSLFFFGIFMYNDNLKSSIADFTSSNPFS
SSFVELPPDECDLFTGQWVFDNKTYPLYKEEECEFLTEQVTCLRNGRKDSLFQNWRWQPR
DCSLPKFNARVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNQTGSLTVF
KIQDYNATVEFYWAPFLVESNSDDPEKHSIIDRIIMPESIEKHGVNWIGVDFLVFNSYIW
WMNTVSIKVLRGSFDDGDTEYDEIKRPIAYERVLRTLGDWVDHNIDPLSTTVFFMSMSPL
HIKSSDWANPEGIRCALETTPILNMSFNVAYGQFSAVGTDYRLFPVAENVTQSLKVPIHF
LNITALSEYRKDAHTSVYTIKQGKLLTREQQNDPANFADCIHWCLPGLPDTWNEFLYTHI
ISRR

MKQTDGRERKAYLSLLYFAVILLPVFLLGCYLYNEKQLRVGQFQEFNTHNLQEHITPLQQ
SKEDKDKKTDLVPLEFCDVFTGKWVLDNVTHPLYKEDECEFLSEWVACTRNGRPDSKYQK
WRWQPQDCSLPRFDSKLLLEKLRGKKLMFIGDSIHYNQWQSMVCMVQSVIPSGKKTLKHT
AQMSIFNIEEYNATISFYWAPFLVESNADPPDKRDGKTDPVIIPNSISKHGENWKDADYL
IFNTYIWWTRHSTIKVLKQESFNKGDSKEYNEIGIYIVYKQVLSTWTKWLEQNINPSQTS
IFFSSMSPTHIRSSDWGFNEGSKCEKETEPILNMSKPINVGTNRRLYEIALNATKSTKVP
IHFLNITTMSEYRKDGHTSFYGSINGKLMTPEQKLDPRTFADCYHWCLPGLPDSWNELLS
LFLLHRERQKVTGRDERATAK

Other information
Ka divergence:-0.156818KaKs divergence:0.226207
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1275Length 2 (bp):1326Length divergence:0.02
MFE 1 (kcal):-381.4MFE 2 (kcal):-350.26MFE divergence-0.043