Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40150-AT3G55990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TRICHOME BIREFRINGENCE-LIKE 28
Function (paralog2):Plant protein of unknown function (DUF828)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.15397971092477
Log2 mRNA fold difference:-0.53765222723464
Log2 TE fold difference:0.52838982475818
Sequences
Protein sequence

MQPSRTRVSFFETGETMKQRKKSYLSIFVIFFSLFFFGIFMYNDNLKSSIADFTSSNPFS
SSFVELPPDECDLFTGQWVFDNKTYPLYKEEECEFLTEQVTCLRNGRKDSLFQNWRWQPR
DCSLPKFNARVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNQTGSLTVF
KIQDYNATVEFYWAPFLVESNSDDPEKHSIIDRIIMPESIEKHGVNWIGVDFLVFNSYIW
WMNTVSIKVLRGSFDDGDTEYDEIKRPIAYERVLRTLGDWVDHNIDPLSTTVFFMSMSPL
HIKSSDWANPEGIRCALETTPILNMSFNVAYGQFSAVGTDYRLFPVAENVTQSLKVPIHF
LNITALSEYRKDAHTSVYTIKQGKLLTREQQNDPANFADCIHWCLPGLPDTWNEFLYTHI
ISRR

MQPWRRKFPLFETGVTMKQRKNSNLSIFVVVFSVFLFGIFMYNEDVKSIAEFPFSTSKPH
DVHDEATPITEITTLPVQESIKNSDPIQESIKNADSVQDSVKDVAEPVQEEVSKTEEVKK
IELFAATEDEEDVELPPEECDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMRNGRRDSL
YQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGRKSL
NKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWKGVD
FLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRRVMRTWGDWVERNIDPLRTT
VFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTHSLNVP
VYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNEFLY
TRIISRS

www.000webhost.com

Other information
Ka divergence:-0.556086KaKs divergence:-0.178273
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1275Length 2 (bp):1464Length divergence:0.069
MFE 1 (kcal):-381.4MFE 2 (kcal):-428.84MFE divergence0.059