Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40240-AT3G56030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.16336652291859
Log2 mRNA fold difference:1.5489577006258
Log2 TE fold difference:-1.5243721943046
Sequences
Protein sequence

MSLLRRRFVKQSVNCITFLQILAERSFSTVKIPPGRRKTTEFDKLINEAGSSGDFETVRR
LLNNRIVLGSFNTSDTFKFLTNTASYSSYLEDLRRVLPQIDGGFSRKNAYDILISRLCKL
GRIDDALIVIGDMSNGRLGLTPSTYHPILCSLTRKYKIEEAWRVVESMRSKSVSMDVTAY
NYFLTSHCYDGELESASEVMRKIEEDGNSPDSRSYDALVLGACRAGKVEAAMAILRRMEE
DGVTVLYSTHAHVITGLVEGGYYALGLEFVMAYAGKDLRLDSESFGFLAGKLVKRKRYEE
AMIVVKEMVMRGLRMGDELRQFYEGNVRYDDDDEDSLVQSERECYIEQKLN

MFRLKPLISVDLNQTMSLLRRFVKEANNSRFLLQSISGRSFSTVNPNPTASPGRRTCVEF
DNLIFKAGSSGDFEAVRRLLNSRVVNACFNTTATFKFLTNTDSYSSSLEDLRRILPQTDA
GYTRKHSYETLIARLCKLGRIDDALVLINDMAIGEFGLSTCVFHPILNTLTKKNRIEEAW
RVVELMRSHAIPVDVTSYNYFLTSHCYDGDVAEASRVLRKMEEEEEGVMSPDTRTYDALV
LGACKSGRVEAAMAILRRMEEEGLSVLYATHAHVIGEMVESGYYALSVEFVMAYAGKDKR
LDEENLGSLASKLIKRKRFKEAKMVLKEMSVRGLRMGDALREFHEKNVLQS

Other information
Ka divergence:-0.0736226KaKs divergence:0.185857
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1056Length 2 (bp):1056Length divergence:0
MFE 1 (kcal):-337.42MFE 2 (kcal):-341.43MFE divergence0.006