Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40270-AT3G56050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase family protein
Function (paralog2):Protein kinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7087399657242
Log2 mRNA fold difference:1.4132797614493
Log2 TE fold difference:0.22145556369615
Sequences
Protein sequence

MLFKMRSFVAFVLLLSWFGSCCSLKDQAVDFLKSEDSLKKDLSSDEDSTYLKAFGFHRKT
LVRNPYKDLPSRKDRKNRVVAATTTPSSSPEPAPKHVSTKASTVSEPQKRSSTQDVSPSP
SAPLANSPIPRNSHSSVPLVVGCVGGAFFLLLVATGLYFFTSKAGKTVNPWRTGLSGQLQ
KVFVTGIPVLKRSEIEAACEDFSNVIGSCPIGKLFKGTLSSGVEIAVASFATTTAKDWKD
STEIHFRKKIEMLSKINHKNFANLLGYCEEKEPFTRILIFEYAPNGSLFEHLHYKESEHL
DWGMRLRIAMGLAYCLDHMHQLNPPIAHTNLVSSSLQLTEDYAVKVSDFSFGSSETETNI
NNNTVIDTHISALNPEDNIYSFGLLLFEMITGKLIESVNKPDSVDSSLVDFLRGETLAKM
VDPTLESYDAKIENIGEVIKSCLRTDPKERPTMQEVTGWLREITGLSPNDATPKLSPLWW
AELEVLSTA

MSNNWKSVRLRLQNRTLVFLLVILSFGSCYSLKSQGDGFLESVTKDLWSDIDAEDLRAVG
FHRKLLGRFRNPYTHLNAFRDRPVARATPPSSSVSTRPDAKRSSTLPPPQKSPPAQHVSA
PPPFVHHVTLPSLTSSSKTSSNSTIPIVAGCIAGAVFILLLATGVFFFKSKAGKSVNPWR
TGLSGQLQKVFITGVPKLKRSEIEAACEDFSNVIGSCPIGTLFKGTLSSGVEIAVASVAT
ASAKEWTNNIEMQFRKKIEMLSKINHKNFVNLLGYCEEEEPFTRILVFEYASNGTVFEHL
HYKESEHLDWVMRLRIAMGIAYCLDHMHGLKPPIVHSNLLSSSVQLTEDYAVKIADFNFG
YLKGPSETESSTNALIDTNISETTQEDNVHSFGLLLFELMTGKLPESVQKGDSIDTGLAV
FLRGKTLREMVDPTIESFDEKIENIGEVIKSCIRADAKQRPIMKEVTGRLREITGLSPDD
TIPKLSPLWWAELEVLSTA

Other information
Ka divergence:-0.022596KaKs divergence:0.108153
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1470Length 2 (bp):1500Length divergence:0.01
MFE 1 (kcal):-388.8MFE 2 (kcal):-449.53MFE divergence0.072