Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40280-AT3G56080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.51257035946231
Log2 mRNA fold difference:-0.59459895825837
Log2 TE fold difference:0.075438395506295
Sequences
Protein sequence

MAISVQHVVVLLLSTLLIAITFFLFTSDNARFPFPSLSTTDYYTPIPKSPIPHRIVDVSS
DQTPQKMKLNTSLEVGELKWDLCKGAESVDYIPCLDNYAAIKQLKSRRHMEHRERHCPEP
SPKCLLPLPDNYKPPVPWPKSRDMIWYDNVPHPKLVEYKKEQNWVKKEGEFLVFPGGGTQ
FKFGVTHYVEFIEKALPSIKWGKNIRVVLDVGCGVASFGGSLLDKDVITMSFAPKDEHEA
QIQFALERGIPATLSVIGTQQLTFPSNAFDLIHCARCRVHWDADGGKPLLELNRVLRPGG
FFIWSATPVYRDNDRDSRIWNEMVSLTKSICWKVVTKTVDSSGIGLVIYQKPTSESCYNK
RSTQDPPLCDKKEANGSWYVPLAKCLSKLPSGNVQSWPELWPKRLVSVKPQSISVKAETL
KKDTEKWSASVSDVYLKHLAVNWSTVRNVMDMNAGFGGFAAALINLPLWVMNVVPVDKPD
TLSVVYDRGLIGVYHDWCESVNTYPRTYDLLHSSFLLGDLTQRCEIVQVVAEIDRIVRPG
GYLVVQDNMETIMKLESILGSLHWSTKIYEDRFLVGRKGFWRPAKPELR

MIKNIFQSRKLSGLCVLSILLVSVTILLLTNDTIDLFPYLSLPYLPRSSLSVIPTSTPIS
SPTNDSSPPLESPVNQTRVDDHPDDQGLELDWLKDDKQWNVSLKIDWKRCESPDYIPCLD
NTKAIKKLKSKRNMEHRERHCPERSPKCLVPLPQHYKVPLPWPQSRDMIWYDNVPHPKLV
EYKKDQNWVRKSGPFFVFPGGGTQFKDGVIHYINFIQKTLPILDWGKKVRVVLDVGCGVA
SFGGTLLDKNVITMSFAPKDEHEAQIQFALERGIPATLAVIGTQKLPFPDNAYDVIHCAR
CRVHWHGYGGRPLLELNRVLRPGGFFVWSATPVYQHDEGHRNVWKTMESLTTSMCWKVVA
RTRFTKVGFVIYQKPDSDSCYESRKNKDPPLCIEEETKKNSSWYTPLLTCLPKLPVSPIG
KWPSGWPERLTETPVSLFREQRSEESFREDSKLWSGVMSNIYLYSLAINWTRIHNVMDMN
AGYGGFAAALINKPLWVMNVIPVEGEDTLSTIFDRGLIGIYHDWCESFNTYPRSYDLLHS
SFLFTNLSQRCDLMEVVVEIDRILRPGGYLAVQDTVEMLKKLNPILLSLRWSTNLYRGKF
LVGLKSSWRP

Other information
Ka divergence:-0.00812806KaKs divergence:-0.17133
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1770Length 2 (bp):1833Length divergence:0.017
MFE 1 (kcal):-522.85MFE 2 (kcal):-551.4MFE divergence0.027