Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40300-AT3G56090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ferritin 4
Function (paralog2):ferritin 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.21352954095599
Log2 mRNA fold difference:0.49786312389526
Log2 TE fold difference:-0.29427267408845
Sequences
Protein sequence

MLLKTVSSSSSSALSLVNFHGVKKDVSPLLPSISSNLRVSSGKSGNLTFSFRASKSSTTD
ALSGVVFEPFKEVKKELDLVPTSSHLSLARQKYSDECEAAINEQINVEYNVSYVYHAMYA
YFDRDNIALKGLAKFFKESSLEEREHAEKLMEYQNKRGGRVKLQSIVMPLSEFEHVDKGD
ALYGMELALSLEKLVNEKLLNLHSVASKNNDVHLADFIESEFLTEQVEAIKLISEYVAQL
RRVGKGHGTWHFNQMLLEG

MLLKAASTFSLLNIHGEKKDISPLFSSSSSISSPVSSGKSGNLSFPLRASKSSTTTTSTL
SGVVFEPFEEVKKEMDLVPSGQQLSLARHLYSPECEAAVNEQINVEYNVSYVYHALYAYF
DRDNVALKGLAKFFKESSVEEREHAELLMEYQNKRGGRVKLQPMVLPQSEFDHPEKGDAL
YAMELALSLEKLVNEKLLNLHSVASKNDDVQLADFIESVFLNEQVEAIKKISEYVSQLRR
LGKGHGTWHFDQELLGAAA

Other information
Ka divergence:0.161518KaKs divergence:-0.19918
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):780Length 2 (bp):780Length divergence:0
MFE 1 (kcal):-237.79MFE 2 (kcal):-243.2MFE divergence0.011