Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40400-AT3G56140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF399 and DUF3411)
Function (paralog2):Protein of unknown function (DUF399 and DUF3411)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.34093726597826
Log2 mRNA fold difference:-0.34067686693349
Log2 TE fold difference:0.02364912894816
Sequences
Protein sequence

MKPTTNGGLLASQSSSSFSFPRFRGQLPIIFSANNNQKKKNLPNPNVVTLCLHSHSNVSS
SQIAVTRRAILVAPPLLAAAASLFLSISSAASAETSAESVALPPVATAPPPPPVEKEEAI
TSRIYDASVLGEPMAVGKDKKRVWEKLLNARIVYLGEAEQVPTRDDKVLELEIVRNLRKR
CIESDRQLSLALEAFPLDLQEQLNQYMDKRMDGEVLKSYVSHWPVQRWQEYEPLLSYCRD
NGVKLIACGTPLKVLRTVQAEGIRGLSESERKLYTPPAGSGFISGFTSFSRSSSLNMNPL
TQIVPFGPSSYLSAQARVVEDHTMSQVIVQAVADGGGTGMLVVVTGANHVEYGSRGTGLP
ARISRKIPKKSQLVVLLDPERQFLRKEGESPVADFLWYSAARPCSRNCFDRAEIARVMNA
AGRRRDALPQDIQKGLDLGLVSPEILQNFFDLEQYPLISELTQRFQGFRERLLADPKFLN
RLAIEEAISITTTLVAQYEKRKENFFEELDYVITDSVRASVVDFFTVWLPAPTLSFISYA
DETIGPNSIDALRGLLGSIPDNAFQKSLGGQEWTLSLRIASVIIGGLKLAGVGVVSSFAA
VGSSNALYAIRKFIKPELGVGEQAKRSPMLKTALVYGGYLGTSSNIRYQIIAGLIEHRIS
DELSSQPLLVNMISFVVRVANSYFGTQQWIDLARSTGLQTQKSVTTSNQIPEVASQSTVE
YSTTEEASMDDLKNQ

MKLTTNDLFASQPLFHCPCSSSSRPRRRRFYGLHFPINLTSEKNNSLSIVALSDSDLPSR
TAFSRRAFLLAPPLLVSAASLFLKPSVSLASEESSSATVTSPAESAAPPPPPATTTPSPP
PPVNKEETITSRIYDATAIGEPMAMGKDKKKVWEKLLNARVVYLGEAEQVPTKDDKELEL
EIVRNLRKRCVESERQISVALEAFPLDLQDQLNQYMDKRMDGETLKSYVTHWPAQRWQEY
EPLLSYCRDNSVRLIACGTPLKVLRTVQAEGIRGLSKSERKLYTPPAGSGFISGFSSFSR
RSTFDMSLPTQIVPFGPSSYLSAQARVVEDHTMSQVILQAVADGGGTGLLLVVTGASHVE
YGSRGTGLPARISRKFPKKNQVVVLLDPERQFLRREGETPVADFLWYSAARPCSRNCFDR
AEIARVMNAAGRRRDALPPDIQNGLDLGLVSPEVLQNLFDLEQYPLISELTQRFQGFRER
LLADPKFLNRLAIEEAISITTTLIAQYEKRKENFFEEIDYVITDTVRGSVVDFFTVWLPA
PTLSFLSYADETTGPDSIDALRGLLGSIPDNAFQKSLAGREWNLNLRIASVIVGGLKLAG
VGVVSSFAAVGASNALNIARKVIKPELVVAEKPKRSPLLKTAMVYGGFLGTSANLRYQII
AGLIEHRLSDELSSQPLLVNAISFVVRTLNSYFGTQQWIDLARSTGLQTQKSIPASKEIS
EALEEPTVECDTTTEEESIDKLNNQ

www.000webhost.com

Other information
Ka divergence:-0.106419KaKs divergence:-0.207845
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2208Length 2 (bp):2238Length divergence:0.007
MFE 1 (kcal):-684.31MFE 2 (kcal):-683.09MFE divergence-0.001