Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40410-AT3G56170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Staphylococcal nuclease homologue
Function (paralog2):Ca-2+ dependent nuclease

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.226490199471
Log2 mRNA fold difference:0.21060764882458
Log2 TE fold difference:-0.0024772926588691
Sequences
Protein sequence

MGNALTFLYGKCCKPTTTDDSLGPHGVSAATVGVSALAHDLFNFEITSQVPEGLGRYVQS
SRKAQANWYRKILEAWKQAKPPPQTAEEASRLVTDILKRNQKADVEGLLSFYGLPLSHTL
VEVTVEAPVSLPEGILFEFQTLPVDPKAVADGDTITVYVSTSEPVVSSSVPREVNLAAVQ
RAKAREKRNYPKADELHQKIIDSGYRVLNIENEEVLARKFRIRLRGIDAPESQMPFGKEA
QEGLLKIVGRKSLKVLVYGEDQYGRCVGDLYCNGIFVQEAMLKKGLAWHYLAYDKRPVLA
KWEKEARQKRIGLWASSNPEKPWDWRKNNRRE

MGNAIRLLRKCLNSHGVSASSGGVSALSRDLLNFETTSQVPEKLGSYVVSSQKAQANWYR
KILEAWKQAKPRPKTPEEASRLVIAALKNHQKADVEGLLSFYGLPSPHNLVEVPTEAPVS
LPKGVRFELNTLPVDTKSVADGDTVTVYVSSKDPLVSSSLPKDVSLAAVKRAKAREKKNY
TEADALHKTIIASGYRMISFQNEEVLAKKFRIRLSGIDSPESKMPYGKEAHDELLKMVEG
KCLKVLVYTEDRYGRCVGDIYCNGKFVQEVMLKKGLAWHYVAYDKRAELAKWENEARQKR
VGLWASSNPEKPWEWRKNKRGGN

www.000webhost.com

Other information
Ka divergence:0.142754KaKs divergence:-0.140783
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):999Length 2 (bp):972Length divergence:-0.014
MFE 1 (kcal):-312.34MFE 2 (kcal):-307.71MFE divergence-0.007