Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40420-AT3G56200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transmembrane amino acid transporter family protein
Function (paralog2):Transmembrane amino acid transporter family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.14538961673077
Log2 mRNA fold difference:0.25816012703026
Log2 TE fold difference:-0.51029295894974
Sequences
Protein sequence

MSPAIKAPLLPNQEPSSSSSENHGSFAGAVFNISTSIVGAGIMAIPAAFKVLGVIPSLSI
IVIIAWLSNVSAGFLMKSSLAGESTTYAGVMKESFGKSGAVAVTVVTMVVTFGSMIIFSI
IIGDVISGNEKDGIIHLGLLQEWFGSHWWNTRFFGLLFIFVFLFLPLVLCRRVERLAFSS
AISFLLALLFVVISSVLAIIALVQGKTKPPRLFPELNDGGLSFFSLFTASPVIVTAFTFH
FNVHPVAFELKDPLNVLSATRISVILCATIYSATGLFCYLLFGDSTMTDVLMNFDQSTSS
SVGSLLNDIVRLSYAIHLMLVFPLLNFSLRANLDELLFPMKLSLVEDNKRFFALTFPLLI
SCFLGAIAIPDIWYFFQFLGSTSTVSIAFIFPAAIVLRNVNGFSTLREKIVASVMLVLAV
ATSIIAISTNIYTFTATEET

MTPQIKTHLLPKQEPSSSENHGSSTSGIVFNVSTSIIGAGIMSMPAAFKVLGIVPAFLII
TIIAWLSTISVGFLMKSTLAGESTTYAGVMKESFGKTGSIAVQIATMVATFGCMIIFSII
IGDVLSGNENGGPEHIGVLQEWFGSYWWNTRIFALLFVYGFVLLPLVLRRRVERLAISSA
VSFLLAVLFVVISSVLAISALVNGQTKNPRLFPELSNGGSFWQLFTASPVIVTAFTFHFN
VHPIGFELKDPLQVIPATKISVILCAAIYFATGLFGYLLFGDATMSDILVNFDQSSGSSI
GSLLNDIVRLSYVLHLMLVFPLLNFSLRANLDELLYPKKPSLEKDTKRFIGLTLALLICC
FLSAIAVPDIWYFFQFMGSTITVSIAFIFPAAIVLRNIHGVSTSREKIVAAIMLVLAVAT
SIIAISTNLYSLAAN

www.000webhost.com

Other information
Ka divergence:-0.208208KaKs divergence:-0.377944
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1323Length 2 (bp):1308Length divergence:-0.006
MFE 1 (kcal):-362.79MFE 2 (kcal):-375.71MFE divergence0.017