Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40435-AT3G56220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):transcription regulators

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.582435220939
Log2 mRNA fold difference:0.1858590544852
Log2 TE fold difference:-0.8147221632254
Sequences
Protein sequence

MVSREQKRGSLQEKFQLLRSITNSHAENDTSIIMDASKYIQKLKQKVERFNQDPTAEQSS
SEPTDPKTPMVTVETLDKGFMINVFSGKNQPGMLVSVLEAFEDIGLNVLEARASCTDSFS
LHAMGLENEDGENMDAEAVKQAVTDAIRSWGEINDPQN

MVSREHKRGSSLREKFHLLRSITDSHAESETSIIVDASKYIKKLKQKVEKINNATTSEQS
FRESSDPNPMVTVETLEKGFMIKVMSRKNEAGMLVCVLETFEDLGLDVVEARVSCTDTFS
LHAIGSSNNDDGDCIDAEAVKQAVAEAIRTWSDSHA

www.000webhost.com

Other information
Ka divergence:0.238415KaKs divergence:0.416442
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):477Length 2 (bp):471Length divergence:-0.006
MFE 1 (kcal):-137.81MFE 2 (kcal):-132.94MFE divergence-0.018