Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40480-AT3G56270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF827)
Function (paralog2):Plant protein of unknown function (DUF827)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.029551467193514
Log2 mRNA fold difference:1.3147554365189
Log2 TE fold difference:-0.10293030182141
Sequences
Protein sequence

MALAEEQHQNYHVAEAIPGTPGIHDVRIQPGSENSGFCVDPVGVSNVPGIRRVGLRAEID
TSPPFGSVQEAVTRFGGRGYWVPFKLDDTFNGEFDIKRMEEHAAELEKDLIVKELETLDV
LEALGSTKRIVEDLKRQLQQEALRCSDQLSSDIKEMNDEHCHHNPMSSPDLILMELKQAK
MNLGKTMDNLVVIQSSVESLNKKMKEEKDFLEKTRAKLTYGFGGPVSLAEELSRIKVKPQ
VQDEPLREQVKMVAEADETGLNLQNKNSLRTAEMRLVAARKMEEAAKAAEALAIAEITML
SSNGESQDDDSEFCFPEPPRSPVTPRGLRIDNDFSTDKSSRRGILKKLEEATEGVKQSKQ
ALEAALNRVEIANVKQLAAENAFRGWTKDSLKGDNFTPLNHTRRSFFSHLNKHHEPLDIL
PKPVLKSNISMRDVLRRKQVPKEDVVAPQRQSLEGQIPRRNVNLSQMLKELKQDVKFSAR
GEKEEVHEEKQYVTQRRKFGFIHITLPLQKQSKKKSSL

MAERQQSPAAETIPGTPVIREVRTGTGSENFNPENTRRGCLRAEIDISPQLYGGRGFWVP
FNLEDNYDCVGEFDIKRMEEQTVELEKDLIMKELETLDLLEALGSTKRIFEDLKWQLQQQ
ALRCKETPQHLRSHSKEMVDEHCHRNPLKSPDLMTMEMKQAGMNLCKTMDDLALIHSYAE
SLNMKTKEEKDVLGVASLAEELNSLKFKPAGPDQVERFNTENLPVNPQCEQIKMVVETYD
TAFHKQSKTCPRTADMRLVAARKMEEAARAAEALALAEMTILSSRRNQDALCFPKTPCFP
LTLKAQMNKELSTNVSRIEILRKLEEANEEVKQSKQALEVALNRVEIASVKQLEAEEAFR
QWNIESWKDQKAVGAKRSMKRESFPQRSFLSHINQHEPLIDLPEPMLKRNVSMGNALNRK
DEKQLVTPRRKFRFIQTHQASIRKTE

Other information
Ka divergence:0.438835KaKs divergence:0.150836
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1557Length 2 (bp):1341Length divergence:-0.075
MFE 1 (kcal):-486.91MFE 2 (kcal):-380.1MFE divergence-0.123