Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40510-AT2G40590
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Ribosomal protein S26e family protein
Function (paralog2):Ribosomal protein S26e family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.045240852674206
Log2 mRNA fold difference:-0.53274356239566
Log2 TE fold difference:0.58434337066094
Sequences
Protein sequence

MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE
GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQPGQAPRP
AGPGAAAAAAPRV

MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE
GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQPGQAPRP
AGPGAAAAPRV

Other information
Ka divergence:-1KaKs divergence:-0.997226
GC content 1 (%):53GC content 2 (%):54GC content divergence:0.009
Length 1 (bp):402Length 2 (bp):396Length divergence:-0.008
MFE 1 (kcal):-146.44MFE 2 (kcal):-137.8MFE divergence-0.03