Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40520-AT3G56320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotidyltransferase family protein
Function (paralog2):PAP/OAS1 substrate-binding domain superfamily

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.22836895957487
Log2 mRNA fold difference:0.13655946895573
Log2 TE fold difference:-0.24742411412494
Sequences
Protein sequence

MADHKGKVPVSLSASSSSLSLSPKTTPIEAEVWLIAEARAQEILCAIQPNYLAERSRNKI
ISNLQTLLWERLGIEVYLFGSMPLKTYLPDGDIDLTVLTHHASEEDCARAVCCVLEAEMG
NSDLQVTGVQYVQAKVKVIKCSIRDVAFDISFNQLAGLGALCFLEQVDKAFGRDHLFKKS
IILVKAWCFYESRILGANSGLISTYALAILVLNIVNMSYSSLSGPLAVLYKFINYYGSFD
WKNYCVTVTGPVPISSLPDITETGNHEVFLDEKFFRECMELYSGETGVVEASRKYFPVKY
YNILDPLKHSNNLGRSVTKGNMVRLRNCFMLGVQKLRDVLTLPGENVGWKLEKFFNVSLE
RNGKGQRQDVEEPVVAFGTGAADYSQLKGDFDRYRNNLIYGKWFHGESLHNWLPPSLDTT
SWANISFYMSRVRNGFNGRNQEGPTSMPNIKQSPNNRRSNGTGTYIPGMSKQSNTAGCSS
SKPSTVKSLPSASETQESKKNP

MGEIQERLSVSSSSSSSSSSLSLSTALPKGDSLPIDADSWMIAEERAHEILCTIQPALVS
DRSRNEIIDYVRTLIMSHEGIEVFSFGSVPLKTYLPDGDIDLTVLTKQNMDDDFYGQLCS
RLQNEERESEFHATDVQFIPAQVKVIKCNIRNIAVDISFNQTAGLCALCFLEQVDQLFGR
DHLFKRSIILVKAWCYYESRILGANTGLISTYALAVLVLYIINLFHSSLSGPLAVLYKFL
DYYGSFDWNNYCISVNGPVPISSLPELTAASPENGHELLLDEKFLRNCVELYSAPTKAVD
SNGLEFPIKHLNIVDPLKYSNNLGKSVTQGNVQRIRHAFTLGARKLRDVLSLPGDTMGWR
LEKFFRNSLERNGKGQRQDVNDPVTAFGTGRSELSELSGDFDSSFGRLVYGQMYHGHSLP
GTFQHGYIPVSSHLSGWDIVRHLVTYRKNEFHLRSLNVSTSMQPFPLHSLPNGCQNMRKT
RGTGTYIPDMSQQVYSDRFRESGTGTSSTNHLEASSEAIDNDGASSCCNLSGEVSTSCTS
NKGEECVRPESVLKSQRSANLELDDNCQFPPPENLVEPRTSSTLVLENGKEESIRSSQTM
NGS

Other information
Ka divergence:-0.376272KaKs divergence:-0.222448
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1509Length 2 (bp):1812Length divergence:0.091
MFE 1 (kcal):-435.89MFE 2 (kcal):-511.44MFE divergence0.08