Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40590-AT3G56340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein S26e family protein
Function (paralog2):Ribosomal protein S26e family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.77052878827646
Log2 mRNA fold difference:0.35248529043567
Log2 TE fold difference:0.45590871026097
Sequences
Protein sequence

MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE
GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQPGQAPRP
AGPGAAAAPRV

MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE
GYTLPKLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPAQPGQAPRP
AGGAPAAPRA

www.000webhost.com

Other information
Ka divergence:-0.114702KaKs divergence:-0.0761905
GC content 1 (%):54GC content 2 (%):52GC content divergence:-0.019
Length 1 (bp):396Length 2 (bp):393Length divergence:-0.004
MFE 1 (kcal):-137.8MFE 2 (kcal):-130MFE divergence-0.029