Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40670-AT3G56380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):response regulator 16
Function (paralog2):response regulator 17

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.14832530260503
Log2 mRNA fold difference:-0.35547290584588
Log2 TE fold difference:0.74702940989286
Sequences
Protein sequence

MNSSGGSCSSLMDVVAYDHHLHHGHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAEN
ALRALEYLGLGDQNQHIDALTCNVMKVSLIITDYCMPGMTGFELLKKVKQESSNLREVPV
VIMSSENIPTRINKCLASGAQMFMQKPLKLADVEKLKCHLMNCRS

MNKGCGSGSDSCLSSMEEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLG
LGDPQQTDSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRI
NKCLASGAQMFMQKPLKLSDVEKLKCHLLNCRS

Other information
Ka divergence:-0.476613KaKs divergence:-0.541441
GC content 1 (%):40GC content 2 (%):39GC content divergence:-0.013
Length 1 (bp):498Length 2 (bp):462Length divergence:-0.038
MFE 1 (kcal):-146.2MFE 2 (kcal):-110.6MFE divergence-0.139