Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40800-AT3G56430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.34735537275709
Log2 mRNA fold difference:-0.1180127165646
Log2 TE fold difference:0.46144485115835
Sequences
Protein sequence

MVKPSDFKAIQGFIRLHYTRVNPVTIGRSNPSALSSPAIPSNGVSQLQPKFSFHSLSSKP
TSKNVGLYQILSSPKLNPKLQQALGLPRVNVSFASAFRLVSTKSSGFRKVDGSFARKVVD
KPVKAVSSTFARYREAIGLHIDAFWKKNSLVVFGAAGVFVCIFLWRIMFGIASTFVGLSE
GMAKYGFLALSSAIVAFSGLYLRSRFTINPDKVYRMTMRKINTAAEILEVMGAPLSGSDL
RAYVMSGGGITFKKFKPTIRSKRCFLLFPVQGSEQKGLVSVEVKKKKGQYDMKLLAVDIP
MASGPDQRLFLIGDEEEYRIGGGLISVLRDPVVKAMAATKEFDNLDRIEEEEDAERELQE
AERKHREEIEKLEKEGS

MVKPSDFKAVHKLIQLHYSRVNLFTTTGWSKLSALSSPALPSNGVSQLQPKSGFHTFSSR
PTSKNFGLSQILPSNGVSQLQPKTSFHSFLSRPTSKNVGLSQILPSPKLVPGLQNCGVAL
VKPRVNMNFVSAFRLFSSSGFRKVDGNFARKVVDKPIKAVSSTFARYRMALGLHVDAFWK
KNNLLVFGAGAVFVCIFLWRVMFGIASTFVGLSEGMAKYGFLALSSAIVAFAGLYLRARF
TINPDKVYRITMRKLNTAADVLEVMGAPLAGSDLRAYVMSGGGITFKKFKPTIRNKRCFL
LFPVQGSERKGLVSVEVKKKKGQYDMKLLAVDIPMASGPDQRLFLIGDEEEYRVGGGLIS
ELRDPVVKAMAATKEFDNLDRIEEEEDAERELQEAERKEREEIELQEAERKEREEFELQE
AERKQREEIEKLEK

Other information
Ka divergence:0.219134KaKs divergence:0.153452
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1134Length 2 (bp):1305Length divergence:0.07
MFE 1 (kcal):-338.21MFE 2 (kcal):-378.62MFE divergence0.056