Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G40810-AT3G56440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homolog of yeast autophagy 18C
Function (paralog2):homolog of yeast autophagy 18 (ATG18) D

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.54209775966213
Log2 mRNA fold difference:1.2111602949505
Log2 TE fold difference:-1.5543395196837
Sequences
Protein sequence

MSSTVSNPQGILQPGSFLLPESESMKKEEAELVSVCWNQDSSCFAAGTSHGFRIYNCEPF
KETFRRELKDGGFKIVEMLFRSNILALVGGGPNSQYPSSKVLIWDDHQSRCISEFAFRSE
IRAVKLRRDRIVVVLEHKIYVYNFMDLRLLHQIETQANPRGLCCLSHHSNTSVLACPGLN
RGEIRVEHFGLNMVQIINAHDSSIACMTLTLDGLLLATASTKGTLIRIFNTMDGTRLQEV
RRGVDRADIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVVGEDSYSTENGALLTQQNYSN
SLQGLVSPTIGTNPGSSLSFMRGVLPKYFSSEWSYAQFHVSEVTQFFAAFGSNNTVAIIG
MDGSFYRCSFDPVNGGEMGQLEYIHFMKMDNRP

MDPRRNFQPGGYDSRNTFTSGSFGPPDFGESDEAELVSVSWNQDYSCFAAGTSHGFRIYN
CEPFKETFRRELKDGGFKIVEMLFRSNILALVGGGPNSQYPSNKVLIWDDHQGRCISEFT
FRSEIRAVKLRRDRIVVVLEHKIYVYNFMDLRLLHQIENMANPRGLCCLSHHMNTSVLAC
PGIRRGEVRVEHFGLNMVQIINAHDSNIACMTLTLDGLLLATASTKGTLIRIFNTMDGTR
LQEVRRGVDRADIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVIGEDAYSTEHETSSNSL
QPLVSPASGANPGSSLSFLRGVLPKYFSSEWSFSQFHVPEVTQYFAAFGAQNTIAIIGLD
GSFYRCNFDPVNGGEMTQLEHFHFLKQDSPR

Other information
Ka divergence:0.220341KaKs divergence:0.29969
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1182Length 2 (bp):1176Length divergence:-0.003
MFE 1 (kcal):-338.46MFE 2 (kcal):-361.3MFE divergence0.033